Patents by Inventor Gregory Alan Stoloff

Gregory Alan Stoloff has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 10231943
    Abstract: The present specification discloses pharmaceutical compositions, methods of preparing such pharmaceutical compositions, and methods and uses of treating a cardiovascular disease in an individual using such pharmaceutical compositions.
    Type: Grant
    Filed: September 12, 2017
    Date of Patent: March 19, 2019
    Assignee: Infirst Healthcare Limited
    Inventors: Robin Mark Bannister, John Brew, Suzanne Jane Dilly, Gregory Alan Stoloff, Wilson Caparros Wanderley
  • Publication number: 20180296511
    Abstract: The present specification discloses pharmaceutical compositions, methods of preparing such pharmaceutical compositions, and methods and uses of treating a chronic inflammation and/or an inflammatory disease in an individual using such pharmaceutical compositions.
    Type: Application
    Filed: June 19, 2018
    Publication date: October 18, 2018
    Applicant: Infirst Healthcare Limited
    Inventors: Robin Mark Bannister, John Brew, Wilson Caparros-Wanderley, Gregory Alan Stoloff, Suzanne Jane Dilly, Gemma Szucs, Olga Pleguezuelos Mateo
  • Patent number: 10034933
    Abstract: The present specification discloses an immunogenic composition comprising polypeptide, wherein each of the polypeptides has no more than 100 amino acids, which polypeptides comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope, wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.
    Type: Grant
    Filed: May 5, 2017
    Date of Patent: July 31, 2018
    Assignee: PepTcell, Ltd.
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderlay
  • Patent number: 10004704
    Abstract: The present specification discloses pharmaceutical compositions, methods of preparing such pharmaceutical compositions, and methods and uses of treating a chronic inflammation and/or an inflammatory disease in an individual using such pharmaceutical compositions.
    Type: Grant
    Filed: May 31, 2016
    Date of Patent: June 26, 2018
    Assignee: Infirst Healthcare Limited
    Inventors: Robin Mark Bannister, John Brew, Wilson Caparros-Wanderley, Gregory Alan Stoloff, Suzanne Jane Dilly, Gemma Szucs, Olga Pleguezuelos Mateo
  • Patent number: 9889191
    Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ?ID?1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ?ID?2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ?ID?3 DLIFLARSALILRGSVAHKSC SEQ?ID?4 PGIADIEDLTLLARSMVVVRP SEQ?ID?5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ?ID?6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.
    Type: Grant
    Filed: August 8, 2016
    Date of Patent: February 13, 2018
    Assignee: PepTcell Limited
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderley
  • Publication number: 20180000763
    Abstract: The present specification discloses pharmaceutical compositions, methods of preparing such pharmaceutical compositions, and methods and uses of treating a cardiovascular disease in an individual using such pharmaceutical compositions.
    Type: Application
    Filed: September 12, 2017
    Publication date: January 4, 2018
    Applicant: Infirst Healthcare Limited
    Inventors: Robin Mark Bannister, John Brew, Suzanne Jane Dilly, Gregory Alan Stoloff, Wilson Caparros Wanderley
  • Patent number: 9789075
    Abstract: The present specification discloses pharmaceutical compositions, methods of preparing such pharmaceutical compositions, and methods and uses of treating a cardiovascular disease in an individual using such pharmaceutical compositions.
    Type: Grant
    Filed: July 25, 2016
    Date of Patent: October 17, 2017
    Assignee: Infirst Helathcare Limited
    Inventors: Robin Mark Bannister, John Brew, Suzanne Jane Dilly, Gregory Alan Stoloff, Wilson Caparros-Wanderley
  • Publication number: 20170281750
    Abstract: The present specification discloses an immunogenic composition comprising polypeptide, wherein each of the polypeptides has no more than 100 amino acids, which polypeptides comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope, wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.
    Type: Application
    Filed: May 5, 2017
    Publication date: October 5, 2017
    Applicant: PepTcell, Ltd.
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderlay
  • Patent number: 9693980
    Abstract: The present specification discloses pharmaceutical compositions, methods of preparing such pharmaceutical compositions, and methods and uses of treating a chronic inflammation and/or an inflammatory disease in an individual using such pharmaceutical compositions.
    Type: Grant
    Filed: May 31, 2016
    Date of Patent: July 4, 2017
    Assignee: Infirst Healthcare Limited
    Inventors: Robin Mark Bannister, John Brew, Wilson Caparros-Wanderley, Gregory Alan Stoloff, Suzanne Jane Dilly, Gemma Szucs, Olga Pleguezuelos Mateo
  • Patent number: 9675686
    Abstract: The present specification discloses an immunogenic composition comprising polypeptide, wherein each of the polypeptides has no more than 100 amino acids, which polypeptides comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope, wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.
    Type: Grant
    Filed: March 12, 2015
    Date of Patent: June 13, 2017
    Assignee: PepTcell, Ltd.
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderlay
  • Publication number: 20170028053
    Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ?ID?1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ?ID?2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ?ID?3 DLIFLARSALILRGSVAHKSC SEQ?ID?4 PGIADIEDLTLLARSMVVVRP SEQ?ID?5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ?ID?6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.
    Type: Application
    Filed: August 8, 2016
    Publication date: February 2, 2017
    Applicant: PepTcell Limited
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderley
  • Publication number: 20160331706
    Abstract: The present specification discloses pharmaceutical compositions, methods of preparing such pharmaceutical compositions, and methods and uses of treating a cardiovascular disease in an individual using such pharmaceutical compositions.
    Type: Application
    Filed: July 25, 2016
    Publication date: November 17, 2016
    Applicant: Infirst Healthcare Limited
    Inventors: Robin Mark Bannister, John Brew, Suzanne Jane Dilly, Gregory Alan Stoloff, Wilson Caparros-Wanderley
  • Publication number: 20160271087
    Abstract: The present specification discloses pharmaceutical compositions, methods of preparing such pharmaceutical compositions, and methods and uses of treating a chronic inflammation and/or an inflammatory disease in an individual using such pharmaceutical compositions.
    Type: Application
    Filed: May 31, 2016
    Publication date: September 22, 2016
    Applicant: Infirst Healthcare Limited
    Inventors: Robin Mark Bannister, John Brew, Wilson Caparros-Wanderley, Gregory Alan Stoloff, Suzanne Jane Dilly, Gemma Szucs, Olga Pleguezuelos Mateo
  • Publication number: 20160271088
    Abstract: The present specification discloses pharmaceutical compositions, methods of preparing such pharmaceutical compositions, and methods and uses of treating a chronic inflammation and/or an inflammatory disease in an individual using such pharmaceutical compositions.
    Type: Application
    Filed: May 31, 2016
    Publication date: September 22, 2016
    Applicant: Infirst Healthcare Limited
    Inventors: Robin Mark Bannister, John Brew, Wilson Caparros-Wanderley, Gregory Alan Stoloff, Suzanne Jane Dilly, Gemma Szucs, Olga Pleguezuelos Mateo
  • Patent number: 9446116
    Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ?ID?1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ?ID?2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ?ID?3 DLIFLARSALILRGSVAHKSC SEQ?ID?4 PGIADIEDLTLLARSMVVVRP SEQ?ID?5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ?ID?6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.
    Type: Grant
    Filed: May 30, 2013
    Date of Patent: September 20, 2016
    Assignee: PepTCell Limited
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderley
  • Patent number: 9427422
    Abstract: The present specification discloses pharmaceutical compositions, methods of preparing such pharmaceutical compositions, and methods and uses of treating a cardiovascular disease in an individual using such pharmaceutical compositions.
    Type: Grant
    Filed: October 21, 2014
    Date of Patent: August 30, 2016
    Assignee: Infirst Healthcare Limited
    Inventors: Robin Mark Bannister, John Brew, Suzanne Jane Dilly, Gregory Alan Stoloff, Wilson Caparros-Wanderley
  • Patent number: 9381180
    Abstract: The present specification discloses pharmaceutical compositions, methods of preparing such pharmaceutical compositions, and methods and uses of treating a chronic inflammation and/or an inflammatory disease in an individual using such pharmaceutical compositions.
    Type: Grant
    Filed: October 21, 2014
    Date of Patent: July 5, 2016
    Assignee: Infirst Healthcare Limited
    Inventors: Robin Mark Bannister, John Brew, Wilson Caparros-Wanderley, Gregory Alan Stoloff, Suzanne Jane Dilly, Gemma Szucs, Olga Pleguezuelos Mateo
  • Patent number: 9326958
    Abstract: The present specification discloses pharmaceutical compositions, methods of preparing such pharmaceutical compositions, and methods and uses of treating a chronic inflammation and/or an inflammatory disease in an individual using such pharmaceutical compositions.
    Type: Grant
    Filed: October 21, 2014
    Date of Patent: May 3, 2016
    Assignee: INFIRST HEALTHCARE LIMITED
    Inventors: Robin Mark Bannister, John Brew, Wilson Caparros-Wanderley, Gregory Alan Stoloff, Suzanne Jane Dilly, Gemma Szucs, Olga Pleguezuelos Mateo
  • Publication number: 20150182618
    Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope: SEQ?ID?1 GDTWAGVEAIIRILQQLLFIHFRIGCQHSR SEQ?ID?2 KVGSLQYLALTALITPKKIKPPLPSVKKLTEDRWNKPQKT SEQ?ID?3 EPVPLQLPPLERLTLDCSEDCGTSGTQ SEQ?ID?4 YKGALDLSHFLKEKGGLEGLIYSQKRQDILDLWVYHTQGYFPD wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.
    Type: Application
    Filed: March 12, 2015
    Publication date: July 2, 2015
    Applicant: PepTcell, Ltd.
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderlay
  • Patent number: RE47222
    Abstract: Provided is a polypeptide composition comprising one or more polypeptides, which polypeptides are immunogenic in a vertebrate such that they cause the vertebrate to produce immune system cells capable of recognizing at least one epitope from an arthropod saliva protein fraction, wherein the arthropod saliva protein fraction has a mass of 40 kDA or less, and wherein the polypeptides are selected independently from: the polypeptide sequences of SEQ ID 1-44 or sub-sequences from these sequences, the sub-sequences having 7 amino acids or more; or from polypeptide sequences having 85% homology or more with one or more of the above sequences and contained in one or more of the following databases: GenBank, Protein Data Bank (PDB), SwissProt, Protein Information Resource (PIR), Protein Research Foundation (PRF), or CDS translations of these.
    Type: Grant
    Filed: March 24, 2017
    Date of Patent: February 5, 2019
    Assignee: Pep Tcell, Ltd.
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderley