Patents by Inventor Guillaume Mitta

Guillaume Mitta has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism
    Patent number: 7531509
    Abstract: An antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows: GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its fragments and a polypeptide, as well as transformed host organisms capable of producing the peptide such as microorganisms, animal cells, digital cells and plants, and an anti-microbial composition containing the peptide.
    Type: Grant
    Filed: March 5, 2004
    Date of Patent: May 12, 2009
    Assignees: Centre National de la Recherche Scientifique—CNRS, Universite de Perpignan
    Inventors: Guillaume Mitta, Richard Galinier, Bernard Banaigs, Eric Lasserre
  • Anti-microbial peptide known as halocyntin, gene coding for said peptide, vector, transformed organism and composition containing said peptide
    Patent number: 7439418
    Abstract: An isolated peptide having an amino acid sequence FWGHIWNAVKRVGANALHGAVTGALS (SEQ ID No. 1), its derivatives and its fragments containing at least 7 amino acids.
    Type: Grant
    Filed: March 5, 2004
    Date of Patent: October 21, 2008
    Assignees: Centre National de la Recherche Scientifique - CNRS, Universite de Perpignan
    Inventors: Guillaume Mitta, Richard Galinier, Bernard Banaigs, Eric Lasserre
  • Anti-microbial peptide known as halocyntin, gene coding for said peptide, vector, transformed organism and composition containing said peptide
    Publication number: 20060218665
    Abstract: An isolated peptide having an amino acid sequence FWGHIWNAVKRVGANALHGAVTGALS (SEQ ID No. 1), its derivatives and its fragments containing at least 7 amino acids.
    Type: Application
    Filed: March 5, 2004
    Publication date: September 28, 2006
    Applicants: Centre National de la Recherche Scientifique(CNRS), Universite de Perpignan
    Inventors: Guillaume Mitta, Richard Galinier, Bernard Banaigs, Eric Lasserre
  • Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism
    Publication number: 20060205640
    Abstract: A antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows: GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its fragments and a polypeptide, as well as transformed host organisms capable of producing the peptide such as microorganisms, animal cells, digital cells and plants, and an anti-microbial composition containing the peptide.
    Type: Application
    Filed: March 5, 2004
    Publication date: September 14, 2006
    Inventors: Guillaume Mitta, Richard Galinier, Bernard Banaigs, Eric Lasserre
  • Antimicrobial peptides derived from mollusks
    Patent number: 6911524
    Abstract: The invention concerns an antimicrobial peptide, called myticin, characterised in that it can be obtained from a bivalve mollusc shellfish, and its molecular mass is about 4.5 kDa; its pI is about 8.7; it comprises 8 cystein radicals. The invention also concerns its preparation and its uses. The invention further concerns a nucleic acid coding for said peptide.
    Type: Grant
    Filed: July 7, 2000
    Date of Patent: June 28, 2005
    Assignees: Centre National de la Recherche Scientifique, Institute Francais de la Recherche pour l'Exploitationde de la Mer (Ifremer)
    Inventors: Philippe Roch, Guillaume Mitta, Florence Hubert, Thierry Noel