Patents by Inventor Helen Frances Evans

Helen Frances Evans has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Human galanin, CDNA clones encoding human galanin and a method of producing human galanin
    Patent number: 5756460
    Abstract: The present invention provides a peptide having the amino acid sequence of human galanin. The amino acid sequence of this peptide is: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS (SEQ ID NO: 1). The present invention further provides DNA clones encoding the peptide and to therapeutic uses of the peptide.
    Type: Grant
    Filed: July 25, 1995
    Date of Patent: May 26, 1998
    Assignee: Garvan Institute of Medical Research
    Inventors: Helen Frances Evans, John Shine