Abstract: A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe comprises a polypeptide represented by the following formula (1), (2), or (3), or a polypeptide having homology with the foregoing polypeptide, (SEQ?ID?NO.?1) Z-HGEGTFTSDLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) (SEQ?ID?NO.?2) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(2) (SEQ?ID?NO.?3) B-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(3) where, in the formulae (1) and (2), “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a radioactive nuclide, and “Z—” indicates that an ?-amino group at an N-terminus is not modified, or is modified with a modifying group having no electric charge; in the formula (3), “B—” indicates that an ?-amino group at an N-terminus is labeled with a radioactive nuclide; and in the formulae (1), (2), and (3), “—NH2” indicates that a carboxyl group at a C-terminus is amidated.

Abstract: A precursor of a molecular probe for imaging of pancreatic islets is provided.

Abstract: A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ?ID?NO.?1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2?(1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.

Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides; polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides; Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2? (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (9) where X in the formulae (1) and (5) and B—in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.

Abstract: A precursor of molecular probe for imaging of pancreatic islets is provided. A polypeptide represented by any one of the following formulae (1) to (4), or a polypeptide having a homology with the foregoing polypeptide. *-DLSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (1) ?*-LSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (2) ??*-SK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (3) ???*-K*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2, (4) wherein *- indicates that an ?-amino group at an N-terminus is protected by a protecting group or modified with a modifying group having no electric charge; K* indicates that an amino group of a side chain of a lysine is protected by a protecting group; and —NH2 indicates that a carboxyl group at a C-terminus is amidated.

Abstract: The present invention provides a radiolabeled ligand which is highly selective and potent for glutamate transporters and is usable in specifically detecting the glutamate transporter. Specifically, the present invention provides a 3-[3-(benzoylamido)benzyloxy]aspartic acid having a radioactive substituent on the benzoyl group which is represented by the following formula (1), or an ester or salt thereof: wherein X represents a substituent containing a radioactive atom(s) which is selected from a straight or branched lower aliphatic alkyl group, a hydroxyl group, a straight or branched lower aliphatic alkoxy group, an amino group, a straight or branched lower aliphatic acylamido group, a halogen atom and a straight or branched lower aliphatic haloalkyl group; and R1 and R2 each represents a hydrogen atom, a straight or branched lower aliphatic alkyl group or an acetoxymethyl group.

Abstract: A radioactive iodine-labeled compound represented by the following formula (I): wherein X represents a radioactive iodine atom which may substitute at an arbitrary position on the benzene ring (preferably 123I, 125I and the like.), n represents an integer of 1 to 3, R1 and R2 each independently represent a substituted or unsubstituted alkyl group, Y represents an alkylene group having 1 to 6 carbon atoms (preferably methylene group), M represents a counter ion, and m represents the number of ions required to neutralize the charge of the molecule. A radioactive iodine-labeled compound that can selectively accumulate in tumor cells or tumor tissue and a scintillation imaging agent containing the compound are provided.

Abstract: A radioactive iodine-labeled compound represented by the following formula (I): wherein X represents a radioactive iodine atom which may substitute at an arbitrary position on the benzene ring (preferably 123I, 125I and the like.), n represents an integer of 1 to 3, R1 and R2 each independently represent a substituted or unsubstituted alkyl group, Y represents an alkylene group having 1 to 6 carbon atoms (preferably methylene group), M represents a counter ion, and m represents the number of ions required to neutralize the charge of the molecule. A radioactive iodine-labeled compound that can selectively accumulate in tumor cells or tumor tissue and a scintillation imaging agent containing the compound are provided.

Abstract: A radioactive iodine-labeled compound represented by the following formula wherein X represents a radioactive iodine atom which may substitute at an arbitrary position on the benzene ring (preferably 123I, 125I and the like.), n represents an integer of 1 to 3, R1 and R2 each independently represent a substituted or unsubstituted alkyl group, Y represents an alkylene group having 1 to 6 carbon atoms (preferably methylene group), M represents a counter ion, and m represents the number of ions required to neutralize the charge of the molecule. A radioactive iodine-labeled compound that can selectively accumulate in tumor cells or tumor tissue and a scintillation imaging agent containing the compound are provided.

Abstract: A radioactive iodine-labeled compound represented by the following formula 1

Abstract: A diagnostic imaging agent useful for selection of a therapy for cancerous bone metastasis is provided, which comprises 99mTc(V)-dimercaptosuccinic acid as an effective ingredient. The agent is administered to a patient, and a scintigram is taken. This is especially useful for identifying osteoclastic type or mixed type bone metastasis or for identifying a disease in which the bone resorption due to osteoclast is enhanced, and thus allows a proper selection of therapies for such diseases.

Abstract: A diagnostic imaging agent useful for selection of a therapy for cancerous bone metastasis is provided, which comprises 99mTc(V)-dimercaptosuccinic acid as an effective ingredient. The agent is administered to a patient, and a scintigram is taken. This is especially useful for identifying osteoclastic type or mixed type bone metastasis or for identifying a disease in which the bone resorption due to osteoclast is enhanced, and thus allows a proper selection of therapies for such diseases.

Abstract: A built-up stepping motor includes upper and lower housings each having an internal space and joined together with a support plate disposed therebetween. The lower housing retains therein a stator and a rotor disposed in the stator, while the upper housing holds therein a reduction gear for reducing the output speed of the motor. The output end of a rotor shaft extends through the support plate and meshes with a first gear of the reduction gear. The upper and lower housings are assembled together by interlocking engagement between locking projections and mating holes. A shock-absorbing damper is disposed between two stator cores to protect them against chattering.

Abstract: An oil regulating pump for supplying oil to an engine, comprises: a pump housing provided with a suction route and a discharge route; a driving shaft inserted into said housing and rotated by the engine; a primary plunger rotated by the driving shaft; a secondary plunger inserted into a hole provided in an end of the primary plunger and formed a pump chamber communicable with the suction route and the discharge route for pumping; a motor provided with a mechanism for converting a rotation movement into a linear movement; a cam shaft abutted on an end of said driving shaft and linearly displaced by said motor, to reciprocate the driving shaft and to change a reciprocation stroke of the driving shaft; and a control device for controlling rotation of the motor.

Abstract: A radioactive or non-radioactive 2-iodobutyrophenone derivative the formula: ##STR1## wherein X is a radioactive or non-radioactive iodine atom. The radioactive compound has a high affinity for dopamine receptors and is very useful as a radioactive diagnostic agent and as a radiopharmaceutical, and the non-radioactive compound also as a high affinity for dopamine receptors and is very useful as a neuroleptic, a sedative, an anodyne, a tranquilizer, etc.

Abstract: An idling speed control device of an internal combustion engine comprising a bypass passage which interconnects the intake passage located upstream of the throttle valve to the intake passage located downstream of the throttle valve. A flow control valve is arranged in the bypass passage and actuated by a step motor for controlling the amount of air flowing within the bypass passage to maintain the idling speed of an engine at a predetermined speed. The step motor comprises a screw threaded valve shaft and a rotor rotatably mounted on the valve shaft and having a screw threaded center hole which is in engagement with the screw threads of the valve shaft. A pair of stop pins, each being engageable with the corresponding end face of the rotor, is fixed onto the valve shaft.

Abstract: An engine comprising a main intake passage having a throttle valve therein. A bypass passage is branched off from the main intake passage located upstream of the throttle valve and is connected to the main intake passage located downstream of the throttle valve. A flow control valve, actuated by a step motor, is arranged in the bypass passage. The step motor comprises a rotor and a stator having exciting coils. When the engine is operating in an idling state, the exciting coils are excited for rotating the step motor in a rotating direction wherein the engine speed approaches a desired idling speed. When the engine speed becomes equal to the desired engine speed and is higher than a predetermined speed, the exciting coil, which was finally excited immediately before the engine speed becomes equal to the desired idling speed, is intermittently excited in order to maintain the step motor stationary.

Abstract: An engine comprising a main intake passage having a throttle valve therein. A bypass passage is branched off from the main intake passage located upstream of the throttle valve and is connected to the main intake passage located downstream of the throttle valve. A flow control valve, actuated by a step motor, is arranged in the bypass passage. The step motor comprises a rotor and a stator having exciting coils. When the engine is operating in an idling state, the exciting coils are excited for rotating the step motor in a rotating direction wherein the engine speed approaches a desired idling speed. When the engine speed becomes equal to the desired engine speed, the exciting operation of the exciting coils is stopped.

Abstract: A radioactive diagnostic agent which comprises deferoxamine, and a physiologically active compound and a radioactive metallic element chemically connected thereto with or without intervention of any other chemical bonding, which is characteristic in having a high stability even after being administered into a human body and showing substantially the same behavior in a human body as said physiologically active compound itself.

Abstract: An idling speed control device of an internal combustion engine comprising a bypass passage which interconnects the intake passage located upstream of the throttle valve to the intake passage located downstream of the throttle valve. A flow control valve is arranged in the bypass passage and actuated by a step motor for controlling the amount of air flowing within the bypass passage to maintain the idling speed of an engine at a predetermined speed. The step motor comprises a screw threaded valve shaft and a rotor rotatably mounted on the valve shaft and having a screw threaded center hole which is in engagement with the screw threads of the valve shaft. The valve shaft is supported by bearings so that the valve shaft cannot be rotated, but is able to move in the axial direction.