Abstract: An electrical connector includes: at least a first housing part and a second housing part, one of the first housing part and the second housing part engaging, at least partially and concentrically, in an other of the first housing part and the second housing part in an engagement region, the first housing part and the second housing part being rotatable relative to one another in the engagement region about an axis of rotation. The first housing part and the second housing part each have a magnetic structure extending, at least in part, circumferentially on an inside or an outside in the engagement region, the respective magnetic structures interacting.

Abstract: Multi-particulate pharmaceutical composition, the particles having a particle size of between 2.2 and 4 mm, preferably 2.5 to 3.1 mm and most preferably about 2.8 mm, each particle comprising: (a) a core containing or carrying at least one pharmaceutically active agent; and (b) at least one layer showing adhesion and/or being crushable in the colon comprising (i) one or more poly(meth)acrylates, and (ii) non-porous inert lubricant, selected from the group consisting of stearates, kaolin, pharmaglass, talcum and mixtures thereof.

Abstract: The invention relates to a pharmaceutical composition comprising first particles and second particles, the first particles comprising at least one opioid or a pharmaceutically acceptable salt thereof, and the second particles comprising at least one opioid antagonist or a pharmaceutically acceptable salt thereof, wherein the first and second particles cannot be distinguished from one another by visually detectable and/or physical properties, wherein the release of the opioid antagonist occurs continuously over a period of 30 minutes to as much as 8 hours after oral administration, and a dosage form containing it for peroral administration. In addition, the invention relates to a pharmaceutical composition that comprises a particle with the opioid and with the opioid antagonist with the above-mentioned release characteristics.

Abstract: The invention relates to the use of a composition comprising kappa opioid receptor antagonists for producing a drug for the treatment of dissociative disorders in humans.

Abstract: Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively.

Abstract: The invention relates to the use of a composition comprising kappa opioid receptor antagonists for producing a drug for the treatment of dissociative disorders in humans.