Patents by Inventor Ingolf F. Nes

Ingolf F. Nes has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 11648289
    Abstract: The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.
    Type: Grant
    Filed: October 1, 2020
    Date of Patent: May 16, 2023
    Assignee: NORWEGIAN UNIVERSITY OF LIFE SCIENCES
    Inventors: Dzung B. Diep, Kirill V. Ovchinnikov, Per E. Kristiansen, Ingolf F. Nes, Tage Thorstensen
  • Patent number: 10851139
    Abstract: The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis. E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.
    Type: Grant
    Filed: December 14, 2017
    Date of Patent: December 1, 2020
    Assignee: NORWEGIAN UNIVERSITY OF LIFE SCIENCES
    Inventors: Dzung B. Diep, Kirill V. Ovchinnikov, Per E. Kristiansen, Ingolf F. Nes, Tage Thorstensen
  • Patent number: 6790951
    Abstract: The present invention concerns the discovery of a new regulatory mechanism for gene expression in lactic acid bacteria (LAB), especially Lactobacillus sake LTH673 or Lactobacillus plantarium C11, that includes previously unrecognized strongly regulable promoter elements. The essential finding is that the expression of genes under the control of a promoter element dependent on the expression of the IF-K-R gene cluster. The expression of the IF-K-R gene cluster is autoinduced by the secreted peptide encoded by IF, thus providing a regulable expression system for a desired protein. The invention further comprises the purified IF protein.
    Type: Grant
    Filed: July 15, 1998
    Date of Patent: September 14, 2004
    Inventors: Vincent G. H. Eijsink, Ingolf F. Nes, May B. Brurberg