Patents by Inventor Isabella ATTINGER

Isabella ATTINGER has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20230372525
    Abstract: The present invention relates to a method for generating an antibody-payload conjugate by means of a microbial transglutaminase (MTG). The method comprises a step of conjugating a linker comprising or having the structure (shown in N—>C direction) Aax-(Sp1)-B1-(Sp2) via a primary amine in the N-terminal residue Aax to a glutamine (Gln) residue comprised in the heavy or light chain of an antibody, wherein Aax is an amino acid having the structure NH2—Y—COOH, wherein Y comprises a substituted or unsubstituted alkyl or heteroalkyl chain; (Sp1) is a chemical spacer or is absent; (Sp2) is a chemical spacer or is absent; and B1 is a linking moiety or a payload. Further the present invention relates to antibody-linker conjugates that have been generated with the method of the invention and uses thereof.
    Type: Application
    Filed: March 2, 2023
    Publication date: November 23, 2023
    Inventors: Romain BERTRAND, Isabella ATTINGER-TOLLER, Dragan GRABULOVSKI, Philipp SPYCHER
  • Publication number: 20230263904
    Abstract: The present invention relates to a method for generating an antibody-payload conjugate by means of a microbial transglutaminase (MTG). The method comprises a step of conjugating a linker comprising the structure (shown in N->C direction) (Sp1)-RK-(Sp2)-B-(Sp3) or (Sp1)-B-(Sp2)-RK-(Sp3) to a Gln residue comprised in an antibody, wherein (Sp1) is a chemical spacer or is absent; (Sp2) is a chemical spacer or is absent; (Sp3) is a chemical spacer or is absent; R is arginine or an arginine derivative or an arginine mimetic; K is lysine or a lysine derivative or a lysine mimetic; B is a linking moiety or a payload; and wherein the linker is conjugated to the Gin residue comprised in the antibody via a primary amine comprised in the side chain of the lysine residue, the lysine derivative or the lysine mimetic. Further, the invention relates to antibody-linker conjugates, antibody-drug conjugates and linker constructs comprising an RK motif.
    Type: Application
    Filed: March 23, 2023
    Publication date: August 24, 2023
    Inventors: Philipp SPYCHER, Philipp PROBST, Isabella ATTINGER-TOLLER, Romain BERTRAND, Ramona STARK, Dragan GRABULOVSKI
  • Patent number: 10364419
    Abstract: The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6)D(X7)SFHKGEKFQIL(X8)(X9)(X10)(X11)(X12)G(X13)(X14)W(X15)(X16)RSLTTG(X17)(X18)G(X19)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X1) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X2) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X3) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X4) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X5) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X6) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X7) is A, V, I, L, M, G, P, R, H or K; (X8) is S, T, N, Q, C, D or E; (X9) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X10) is A, V, I, L, M, G or P; (X11) is F, Y, W, R, H or K; (X12) is S, T, N, Q, C, F, Y or W; (X13) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X14) is
    Type: Grant
    Filed: September 25, 2017
    Date of Patent: July 30, 2019
    Assignee: Covagen AG
    Inventors: Fabian Buller, Ulrich Wüllner, Irene Zbinden, Isabella Attinger-Toller, Ulrike Von Der Bey, Susann König-Friedrich, Julian Bertschinger, Dragan Grabulovski, Patricia Henne
  • Patent number: 10323095
    Abstract: Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.
    Type: Grant
    Filed: March 16, 2015
    Date of Patent: June 18, 2019
    Assignee: MITSUBISHI TANABE PHARMA CORPORATION
    Inventors: Roland Newman, Steve Granger, Michael Lyman, Dragan Grabulovski, Richard Woods, Michela Silacci, Wenjuan Zha, Isabella Attinger-Toller
  • Publication number: 20190169581
    Abstract: The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6)D(X7)SFHKGEKFQIL(X8)(X9)(X10)(X11)(X12)G(X13)(X14)W(X15)(X16)RSLTTG(X17)(X18)G(X19)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X1) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X2) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X3) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X4) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X5) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X6) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X7) is A, V, I, L, M, G, P, R, H or K; (X8) is S, T, N, Q, C, D or E; (X9) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X10) is A, V, I, L, M, G or P; (X11) is F, Y, W, R, H or K; (X12) is S, T, N, Q, C, F, Y or W; (X13) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X14) is
    Type: Application
    Filed: September 25, 2017
    Publication date: June 6, 2019
    Applicant: COVAGEN AG
    Inventors: Fabian Buller, Ulrich Wüllner, Irene Zbinden, Isabella Attinger-Toller, Ulrike Von Der Bey, Susann König-Friedrich, Julian Bertschinger, Dragan Grabulovski, Patricia Henne
  • Publication number: 20190153096
    Abstract: Advantageous bispecific binding molecules that comprise a CD3 binding and a CD33 binding part are provided. The CD3 binding part comprises an antibody that has variations in the Fc region with reduced binding to C1q and Fc gamma receptors. The bispecific binding molecules can be used in the treatment of cancer.
    Type: Application
    Filed: September 25, 2018
    Publication date: May 23, 2019
    Applicant: Covagen AG
    Inventors: Simon Brack, Kristina Klupsch, Isabella Attinger-Toller, Fabian Buller, Adrian Zumsteg, Julian Bertschinger, Dragan Grabulovski, Vanessa Baeriswyl, Joana Roquette, Roland Scholz, Roger Santimaria, David Senn, Elena Kage, Clara Albani
  • Publication number: 20190100587
    Abstract: Antibody and other Fc-containing molecules with variations in the Fc region with reduced binding to C1q and Fc gamma receptors are provided, which can be used in the treatment of various diseases and disorders.
    Type: Application
    Filed: September 24, 2018
    Publication date: April 4, 2019
    Applicant: Covagen AG
    Inventors: Simon Brack, Isabella Attinger-Toller, Fabian Buller, Dragan Grabulovski, Julian Bertschinger, Adrian Zumsteg
  • Patent number: 9790475
    Abstract: The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5) (X6)D(X7)SFHKGEKFQIL(X8)(X9)(X10)(X11)(X12)G(X13)(X14)W(X15)(X16)RSLTTG(X17)(X18)G(X19)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X1) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X2) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X3) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X4) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X5) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X6) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X7) is A, V, I, L, M, G, P, R, H or K; (X8) is S, T, N, Q, C, D or E; (X9) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X10) is A, V, I, L, M, G or P; (X11) is F, Y, W, R, H or K; (X12) is S, T, N, Q, C, F, Y or W; (X13) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X14) is
    Type: Grant
    Filed: December 18, 2013
    Date of Patent: October 17, 2017
    Assignee: Covagen AG
    Inventors: Fabian Buller, Ulrich Wüllner, Irene Zbinden, Isabella Attinger-Toller, Ulrike Von Der Bey, Susann König-Friedrich, Julian Bertschinger, Dragan Grabulovski, Patricia Henne
  • Publication number: 20170081412
    Abstract: Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.
    Type: Application
    Filed: March 16, 2015
    Publication date: March 23, 2017
    Applicant: MITSUBISHI TANABE PHARMA CORPORATION
    Inventors: Roland NEWMAN, Steve GRANGER, Michael LYMAN, Dragan GRABULOVSKI, Richard WOODS, Michela SILACCI, Wenjuan ZHA, Isabella ATTINGER-TOLLER
  • Patent number: 9315557
    Abstract: The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.
    Type: Grant
    Filed: September 19, 2013
    Date of Patent: April 19, 2016
    Assignee: Covagen AG
    Inventors: Michela Sillacci Melkko, Nadja Banziger, Richard Woods, Wenjuan Zha, Isabella Attinger, Roger Santimaria, Wibke Lembke, Sarah Batey, Ulrike Von Der Bey, Julian Bertschinger, Dragan Grabulovski
  • Publication number: 20160076011
    Abstract: The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5) (X6)D(X7)SFHKGEKFQIL(X8)(X9)(X10)(X11)(X12)G(X13)(X14)W(X15)(X16)RSLTTG(X17)(X18)G(X19)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X1) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X2) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X3) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X4) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X5) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X6) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X7) is A, V, I, L, M, G, P, R, H or K; (X8) is S, T, N, Q, C, D or E; (X9) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X10) is A, V, I, L, M, G or P; (X11) is F, Y, W, R, H or K; (X12) is S, T, N, Q, C, F, Y or W; (X13) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X14) is
    Type: Application
    Filed: December 18, 2013
    Publication date: March 17, 2016
    Applicant: COVAGEN AG
    Inventors: Fabian Buller, Ulrich Wüllner, Irene Zbinden, Isabella Attinger-Toller, Ulrike Von Der Bey, Susann König-Friedrich, Julian Bertschinger, Dragan Grabulovski, Patricia Henne
  • Publication number: 20150322125
    Abstract: The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.
    Type: Application
    Filed: September 19, 2013
    Publication date: November 12, 2015
    Inventors: Michela SILACCI MELKKO, Nadja BANZIGER, Richard WOODS, Wenjuan ZHA, Isabella ATTINGER, Roger SANTIMARIA, Wibke LEMBKE, Sarah BATEY, Ulrike VON DER BEY, Julian BERTSCHINGER, Dragan GRABULOVSKI