Patents by Inventor Jacques Remacle

Jacques Remacle has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 7435806
    Abstract: A method of identifying transcription factors comprising providing cells with a nucleic acid sequence at least comprising a sequence CACCT (SEQ ID NO:1) as bait for the screening of a library encoding potential transcription factors and performing a specificity test to isolate said factors. Preferably, the bait comprises twice the CACCT (SEQ ID NO:1) sequence, more particularly the bait comprises one of the sequences CACCT-N-CACCT (a first SEQ ID NO:1 and a second SEQ ID NO:1 separated by N), CACCT-N-AGGTG (SEQ ID NO:1 and SEQ ID NO:3 separated by N), AGGTG-N-CACCT (SEQ ID NO:3 and SEQ ID NO:1 separated by N), or AGGTG-N-AGGTG (a first SEQ ID NO:3 and a second SEQ ID NO:3 separated by N), wherein N is a spacer sequence. The transcription factors identified using the methods of the invention include separated clusters of zinc fingers, such as, for example, a two-handed zinc finger transcription factor.
    Type: Grant
    Filed: August 3, 2005
    Date of Patent: October 14, 2008
    Assignee: Vlaams Interuniversitair Instituut voor Biotechnologie vzw
    Inventors: Danny Huylebroeck, Kristin Verschueren, Jacques Remacle
  • Publication number: 20050272090
    Abstract: A method of identifying transcription factors comprising providing cells with a nucleic acid sequence at least comprising a sequence CACCT (SEQ ID NO:1) as bait for the screening of a library encoding potential transcription factors and performing a specificity test to isolate said factors. Preferably, the bait comprises twice the CACCT (SEQ ID NO:1) sequence, more particularly the bait comprises one of the sequences CACCT-N-CACCT (a first SEQ ID NO:1 and a second SEQ ID NO:1 separated by N), CACCT-N-AGGTG (SEQ ID NO:1 and SEQ ID NO:3 separated by N), AGGTG-N-CACCT (SEQ ID NO:3 and SEQ ID NO:1 separated by N), or AGGTG-N-AGGTG (a first SEQ ID NO:3 and a second SEQ ID NO:3 separated by N), wherein N is a spacer sequence. The transcription factors identified using the methods of the invention include separated clusters of zinc fingers, such as, for example, a two-handed zinc finger transcription factor.
    Type: Application
    Filed: August 3, 2005
    Publication date: December 8, 2005
    Inventors: Danny Huylebroeck, Kristin Verschueren, Jacques Remacle
  • Publication number: 20050101769
    Abstract: The present invention relates to novel proteins interacting with the cytoplasmic domain of CD40, which are useful in the treatment of CD40 and/or NF-K?B related diseases. Surprisingly, these proteins do not show significant homology with the TRAF-protein family and, therefore, offer the possibility to modulate the CD40 and/or NF-?B pathway independently from the TRAF-CD40 interaction.
    Type: Application
    Filed: January 15, 2004
    Publication date: May 12, 2005
    Applicant: Vlaams Interuniversitair Instituut Voor Biotechnologies VZW
    Inventors: Stefan Pype, Jacques Remacle, Danny Huylebroeck
  • Patent number: 6884779
    Abstract: The current invention concerns SMAD-interacting protein(s) obtainable by a two-hybrid screening assay whereby SMAD1 C-domain fused to GAL4 DNA-binding domain as “bait” and a cDNA library from mouse embryo as “prey” are used. Some characteristics of a specific SMAD-interacting protein (SIP1) of the family of zinc finger/homeodomain proteins including d-crystallin enhancer binding protein and/or Drosophila zfh-1 include an inability to interact with full-size XSMAD1 in yeast, SIP1CZF binds to E2 box sites, SIP1CZF binds to the Brachyury protein binding site and interferes with Brachyury-mediated transcription activation in cells and also interacts with the C-domain of SMAD 1, 2 and 5. The minimal length of the amino acid sequence necessary for binding with SMAD appears to be a 51 amino acid domain encompassing amino acids 166-216 of SEQ ID NO: 2 having the amino acid sequence as depicted in the one letter code: QHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKTEDISKLK (SEQ ID NO: 21).
    Type: Grant
    Filed: September 26, 2001
    Date of Patent: April 26, 2005
    Assignee: Vlaams Interuniversitair Instituut voor Biotechnologie VZW
    Inventors: Kristin Verschueren, Jacques Remacle, Danny Huylebroeck
  • Publication number: 20030044809
    Abstract: A method of identifying transcription factors comprising providing cells with a nucleic acid sequence at least comprising a sequence CACCT (SEQ ID NO: ______ ) as bait for the screening of a library encoding potential transcription factors and performing a specificity test to isolate said factors. Preferably, the bait comprises twice the CACCT (SEQ ID NO: ______ ) sequence, more particularly the bait comprises one of the sequences CACCT-N-CACCT(SEQ ID NO: ______ ), CACCT-N-AGGTG(SEQ ID NO: ______ ), AGGTG-N-CACCT(SEQ ID NO: ______ ), or AGGTG-N-AGGTG (SEQ ID NO: ______ ) wherein N is a spacer sequence. The transcription factors identified using the methods of the invention include separated clusters of zinc fingers, such as, for example, a two-handed zinc finger transcription factor. Also, at least one such zinc finger transcription factor, denominated as SIP1, induces tumor metastasis by down regulation of the expression of E-cadherin.
    Type: Application
    Filed: December 21, 2001
    Publication date: March 6, 2003
    Inventors: Danny Huylebroeck, Kristin Verschueren, Jacques Remacle
  • Publication number: 20020035246
    Abstract: The current invention concerns SMAD interacting protein(s) obtainable by a two-hybrid screening assay whereby SMAD1 C-domain fused to GAL4 DNA-binding domain as “bait” and a cDNA library from mouse embryo as “prey” are used. Some characteristics of a specific SMAD interacting protein (SIP1) of the family of zinc finger/homeodomain proteins including d-crystallin enhancer binding protein and/or Drosophila zfh-1 include an inability to interact with full size XSMAD1 in yeast, SIP1czf binds to E2 box sites, SIP1czf binds to the Brachyury protein binding site and interferes with Brachyury-mediated transcription activation in cells and also interacts with C-domain of SMAD 1, 2 and 5. The minimal length of the amino acid sequence necessary for binding with SMAD appears to be a 51 amino acid domain encompassing amino acids 166-216 of SEQ ID NO: 2 having the amino acid sequence as depicted in the one letter code: QHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKTEDISKLK.
    Type: Application
    Filed: September 26, 2001
    Publication date: March 21, 2002
    Inventors: Kristin Verschueren, Jacques Remacle, Danny Huylebroeck
  • Patent number: 6313280
    Abstract: The current invention concerns SMAD interacting protein(s) obtainable by a two-hybrid screening assay whereby SMAD1 C-domain fused to GAL4 DNA-binding domain as bait and a cDNA library from mouse embryo as prey are used. Some characteristics of a specific SMAD interacting protein (SIP1) of the family of zinc finger/homeodomain proteins including &dgr;-crystallin enhancer binding protein and/or Drosophila zfh-1 include an inability to interact with full size XSMAD1 in yeast, SIP1czf binds to E2 box sites, SIP1czf binds to the Brachyury protein binding site and interferes with Brachyury-mediated transcription activation in cells and also interacts with C-domain of SMAD 1, 2 and 5. The minimal length of the amino acid sequence necessary for binding with SMAD appears to be a 51 amino acid domain encompassing amino acids 166-216 of SEQ ID NO 2 having the amino acid sequence as depicted in the one letter code: QHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKTEDISKLK (SEQ ID NO. 21).
    Type: Grant
    Filed: November 24, 1999
    Date of Patent: November 6, 2001
    Assignee: Vlaams Interuniversitair Instituut Voor Biotechnologie
    Inventors: Kristin Verschueren, Jacques Remacle, Danny Huylebroeck