Abstract: The present disclosure provides a battery charging current control device. The battery charging current control device comprises an H-bridge circuit, a sampling circuit, a control circuit and a pulse width modulation circuit, wherein the H-bridge circuit is respectively connected with an external power supply and a battery and used for transmitting current from the external power supply to the battery for supplying power for the battery; the sampling circuit is connected with the H-bridge circuit and used for collecting an output current and an output voltage of the H-bridge circuit to obtain a current analog signal and a voltage analog signal; the control circuit is connected with the sampling circuit and used for generating a control signal according to the current analog signal, the voltage analog signal and the capacity of the battery; and the pulse width modulation circuit is respectively connected with the control circuit.

Abstract: Disclosed are methods of message processing, apparatuses therefor, and an electronic device. An implementation of the disclosure includes: presenting, responsive to a user's preset trigger operation in a target conversation, a schedule set area and a scheduled send button in the target conversation; determining a message send time set by the user via the schedule set area; and retrieving, after the user triggers the scheduled send button, message content in a message input box of the target conversation as message content for a target scheduled message, and creating the target scheduled message according to the message send time. This implementation realizes direct creation of a scheduled message via a message input box of an instant messaging client, facilitates converting an edited instant message to a scheduled message, extends functions of the instant messaging client, and enhances user experience.

Abstract: An embodiment of this application provides a method and apparatus for testing control software, and a computer-readable storage medium to reduce the time consumed in the simulation-based debugging and enhance efficiency. The method may include obtaining test information of a plurality of fault signals; and injecting, based on the test information of the plurality of fault signals, the plurality of fault signals into a simulation environment in sequence to obtain test results of the plurality of fault signals handled by the control software, where the simulation environment may be a simulation environment of a control object of the control software.

Abstract: A computer-implemented method for optimizing the placement of previously selected breaks in a media item is provided herein. Embodiments of the method include steps of identifying a break in a media item, the break being associated with a first break point at a first time during playback of the media item. The method may also include steps of dynamically adjusting the placement of the breaks within the media item based on the performance of the media item.

Abstract: A voltage attack detection circuit includes at least one voltage regulation circuit, at least one voltage sensor and at least one glitch sensor. The at least one voltage sensor is configured to receive at least one first voltage output by the at least one voltage regulation circuit respectively, and output at least one first signal respectively. The at least one first signal is configured to indicate whether it is under voltage attack of a duration in a first range and an attack strength in a second range respectively. The at least one glitch sensor is configured to receive at least one first voltage respectively, and configured to output at least one second signal respectively. The at least one second signal is configured to indicate whether it is under voltage attack of a duration in a third range and an attack strength in a fourth range.

Abstract: A method or system for estimating delays in design under tests (DUTs) using machine learning. The system accesses multiple DUTs, each comprising various logic blocks. For each DUT, a combinatorial path is identified, connecting one or more logic blocks. A feature vector is generated, including values of orthogonal features representing the combinatorial path's characteristics. Each DUT is compiled for emulation, and the delay of its combinatorial path is measured. These measured delays, along with the corresponding feature vectors, are used to train a machine learning delay model. The trained model is designed to receive a combinatorial path of a DUT as input and generate an estimated wire delay as output. This approach leverages machine learning to predict delays in electronic designs, improving the efficiency and accuracy of delay estimations in complex circuits.

Abstract: A voltage attack detection circuit of a chip includes: a first programmable resistor and a second programmable resistor, a first terminal of the first programmable resistor is connected to a supply voltage, a second terminal of the first programmable resistor is connected to a ground voltage through the second programmable resistor, the first terminal outputs a first voltage, the second terminal outputs a second voltage; a voltage detection circuit, receives the first voltage and a first reference voltage and output a first signal, where the first signal is configured to indicate whether the first voltage is greater than or equal to the first reference voltage, the voltage detection circuit is further configured to receive the second voltage and a second reference voltage and output a second signal, and the second signal is configured to indicate whether the second voltage is less than or equal to the second reference voltage.

Abstract: An isolated IgG antibody includes two identical heavy chains each having a hinge region with an amino acid sequence containing an additional cysteine upstream of the two cysteines in the CPPCP sequence of a native IgG hinge region, and a CH1 domain containing a cysteine at the position of 142 according to the IMGT numbering scheme. ADCs based on the antibody having this architecture are also provided.

Abstract: An audio playback method, a failure detection method for a screen sound production component, and an electronic device. The audio playback method includes: receiving an audio playback instruction; where the audio playback instruction is used to instruct the electronic device to play a first audio; playing, in response to receiving the audio playback instruction, a detection audio by using the screen sound production component; obtaining a first parameter in a process of playing the detection audio; determining, based on the first parameter, whether the screen sound production component fails; where the first parameter is at least one of a real-time load current, a real-time load voltage, a real-time impedance, and a real-time admittance of the screen sound production component; and when the screen sound production component fails, switching the sound production component to the speaker, and playing the first audio by using the speaker.

Abstract: A clamping triaxial seepage and acoustic coupling rock tensile testing machine includes a sample and a scaffold-type tensile testing device. The scaffold-type tensile testing device has an upper chuck and a lower chuck. The upper chuck has an acoustic transmitting channel, one end of which communicating with the outside, and the other end of which having an acoustic transmitting probe. The lower chuck has an acoustic receiving channel, one end of which communicating with the outside, and the other end having acoustic receiving probe. An upper end face of the sample has with a seepage outflow hole while the upper chuck has a seepage outflow channel connected with the seepage outflow hole. A lower end face of the sample has a seepage inflow hole while the lower chuck has a seepage entry channel is connected with the seepage inflow hole.

Abstract: Methods and systems for time marking of media items at a platform using machine-learning are provided herein. An indication of a identified media item is provided as input to a machine-learning model and one or more outputs of the machine-learning model is obtained. The one or more obtained outputs comprise time marks identifying each of the plurality of content segments of the media item. Each of the plurality of content segments is associated with a segment start indicator for a timeline of the media item. A resulting duration is determined of a combination of the plurality of content segments for which the time marks were obtained from the one or more of outputs of the machine-learning model. Responsive to determining that the resulting duration is less than the duration of the media item, one or more further inputs is provided to the machine learning model.

Abstract: A signaling-type method for mobile phone signals, comprising: establishing a shielding processing system, and ensuring that the frequency reference of said system is synchronized with that of a base station; using the feature that a frame signal of a base station is repeatedly transmitted according to a frame period of the base station, receiving the frame signal of the base station at different times; performing filtering processing on the frame signals of the base station using a frame averaging method, so as to obtain purified frame reference signals of the base station; and using the purified frame reference signals to shield the base station.

Abstract: A polarizer includes a light-transmissible substrate, a plurality of metal wires, and a protective layer. The light-transmissible substrate has a mounting surface. The metal wires are parallelly arranged on the mounting surface of the light-transmissible substrate. Each of the metal wires extends in a direction parallel to the mounting surface, and has an upper surface and a peripheral surface. The protective layer has a first portion and a plurality of second portions. The first portion covers the upper surface of each of the metal wires and is formed into a continuous structure. Each of the second portions covers the peripheral surface of a respective one of the metal wires. Two adjacent ones of the second portions are spaced apart from each other. A light emitting device including the polarizer and a light emitting apparatus including the light emitting device are also disclosed.

Abstract: Methods and systems for predicting titles for contents segments of media items at a platform using machine-learning are provided herein. A media item is provided to users of a platform, the media item having a plurality of content segments comprising a first content segment and a second content segment preceding the first content segment in the media item. The first content segment and a title of the second content segment are provided as input to a machine-learning model trained to predict a title for the first content segment that is consistent with the title of the second content segment. One or more outputs of the machine-learning model are obtained which indicate the title for the first content segment. An indication of each content segment and a respective title of each content segment are provided for presentation to at least one user of the one or more users.

Abstract: Methods and systems for time marking of media items at a platform using machine-learning are provided herein. A media item is provided to users of a platform. An indication of the identified media item is provided as input to a machine-learning model that is trained using different feature types of historical media items to predict a plurality of content segments of a given media item each depicting, to the one or more users, a distinct section of the media item. One or more outputs of the machine-learning model are obtained comprising time marks identifying each of the plurality of content segments of the media item. Each of the plurality of content segments are associated with a segment start indicator for a timeline of the media item. The media item and an indication of each segment start indicator is provided for presentation to at least one user.

Abstract: Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X1 is selected from Y or F, and X2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.

Abstract: A light emitting device includes at least one light emitting and connecting unit that includes an epitaxial layer structure and a metallic connecting layer structure, and an insulating substrate that has a main substrate body and first and second contact members. The connecting layer structure interconnects the epitaxial layer structure and the main substrate body, and is completely plane at least right under the epitaxial layer structure. The contact members extend from a first surface to a second surface on the main substrate body, and are disposed outside an imaginary projection of the epitaxial layer structure on the main substrate body. The first contact member is electrically connected with the connecting layer structure. Alight emitting apparatus including the device is also disclosed.

Abstract: An imaging assembly includes a first lens, a second lens, and a third lens. The imaging assembly satisfies the following relational expressions: 0.9<|f2/f|<2.4 and 0.23<?11/TTL<0.45. The illumination and projection apparatus includes the imaging assembly, a housing with a light inlet and a light outlet, and an illumination assembly disposed in a first accommodating space of the housing. The imaging assembly is clamped in a second accommodating space of the housing. The imaging assembly blocks the light outlet, and the illumination assembly blocks the light inlet, which improves sealing performance of the illumination and projection apparatus. An aperture of the second accommodating space is smaller than an aperture of a first accommodating space, which facilitates installation of the imaging assembly and the illumination assembly, and improves convenience of installing the illumination and projection apparatus.

Abstract: An industrial robot motion accuracy compensation method includes: establishing a motion parameter database, wherein the motion parameter database includes a plurality of different reference operating conditions and a motion parameter of the industrial robot corresponding to each reference operating condition, and each reference operating condition is formed by combining each element in each set in a total set of operation conditions; acquiring a current operating condition of the industrial robot; determining whether there is a reference operating condition matched with the current operating condition in the motion parameter database; if yes, taking a motion parameter corresponding to the matched reference operating condition as a motion parameter corresponding to the current operating condition; if no, performing an interpolation on a motion parameter corresponding to the current operating condition, and taking an interpolation result as the motion parameter corresponding to the current operating condition.

Abstract: The present invention relates to a neural network-based high-resolution image restoration method and system, including: performing feature extraction on a target frame in a network input to obtain a first feature, performing feature extraction on a first frame and an adjacent frame and an optical flow between the first frame and the adjacent frame to obtain a second feature, and concatenating the first feature and the second feature to obtain a shallow layer feature; performing feature extraction and refinement on the shallow layer feature to obtain a plurality of output first features and a plurality of output second features; performing feature decoding on the plurality of output second features, and concatenating decoded features along channel dimensionality to obtain features; and performing weight distribution on the features to obtain final features, and restoring an image. The present invention can effectively help to improve image quality.