Patents by Inventor Jianhai Zhang
Jianhai Zhang has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).
-
Publication number: 20250118072Abstract: Provides is a method for detecting a complex target in pedestrian re-identification video streams based on an event-related potential (ERP). According to the method, video streams of a complex target in different scenarios are collected, and are made into experimental paradigms, and electroencephalogram (EEG) data of a subject during watching of a video content is collected. Then brain electrical activity mapping (BEAM) is analyzed, and ERP features are marked, including P300 and P300-D, which correspond to target emergence and target disappearance respectively. Positive and negative sample pairs are constructed, and essential features between classes are obtained based on a method of contrastive representation learning and a method of spatial-temporal feature attention extraction, so as to solve the extreme class imbalance problem of samples and the problem of how to distinguish between two similar classes in a video paradigm.Type: ApplicationFiled: October 7, 2024Publication date: April 10, 2025Inventors: Wanzeng KONG, Chenyi HONG, Jiabin ZHU, Longjie MA, Li ZHU, Jianhai ZHANG
-
Publication number: 20250001174Abstract: An electric stimulation method based on inspiration of healthy side lower limb muscle synergy and a system thereof are provided. A motion process of a healthy side limb of an individual is analyzed, and in combination with an electromyographic signal and a motion posture signal, a muscle motion model which is more in line with coordination of an individual's own limb is established, and the healthy side limb muscle motion model is used to guide the affected limb to move. Inspired by the healthy side limb of an individual, the electromyographic signal and the motion posture signal of the healthy side limb are acquired, and the motion model of the healthy side limb is established. The change relationship of the muscle synergy activation degree with the time is mapped as the change relationship of the muscle synergy activation degree with the angle, which eliminates time-varying interference.Type: ApplicationFiled: March 5, 2024Publication date: January 2, 2025Inventors: Jianhai Zhang, Shikai Huang, Shuai Hu, Hua Ye, Luzhou Zheng
-
Patent number: 11635361Abstract: The present disclosure relates to a traceable in-situ micro- and nano-indentation testing instrument and method under variable temperature conditions. A macro-micro switchable mechanical loading module, a nano mechanical loading module and an indentation position optical positioning module are fixed on a gantry beam, an optical imaging axis of an optical microscopic in-situ observation or alignment module and a loading axis of the nano mechanical loading module are coplanar, the optical microscopic in-situ observation or alignment module and the function switchable module are mounted on a table top of a marble pedestal, and a contact or ambient mixed variable temperature module is fixedly mounted on the function switchable module. A modular design is adopted, the micro- and nano-indentation testing instrument is used as a core, in combination with a multi-stage vacuum or ambient chamber, an indentation depth traceability calibration module and multiple sets of optical microscopic imaging assemblies.Type: GrantFiled: July 14, 2021Date of Patent: April 25, 2023Assignee: Jilin UniversityInventors: Hongwei Zhao, Zhaoxin Wang, Jianhai Zhang, Peng Liu, Shunbo Wang, Cong Li, Xiangyu Zong, Shuilong Zhou, Honglong Li, Jiru Wang, Meng Zhang, Wenyang Wang
-
Publication number: 20220018748Abstract: The present disclosure relates to a traceable in-situ micro- and nano-indentation testing instrument and method under variable temperature conditions. A macro-micro switchable mechanical loading module, a nano mechanical loading module and an indentation position optical positioning module are fixed on a gantry beam, an optical imaging axis of an optical microscopic in-situ observation or alignment module and a loading axis of the nano mechanical loading module are coplanar, the optical microscopic in-situ observation or alignment module and the function switchable module are mounted on a table top of a marble pedestal, and a contact or ambient mixed variable temperature module is fixedly mounted on the function switchable module. A modular design is adopted, the micro- and nano-indentation testing instrument is used as a core, in combination with a multi-stage vacuum or ambient chamber, an indentation depth traceability calibration module and multiple sets of optical microscopic imaging assemblies.Type: ApplicationFiled: July 14, 2021Publication date: January 20, 2022Inventors: Hongwei Zhao, Zhaoxin Wang, Jianhai Zhang, Peng Liu, Shunbo Wang, Cong Li, Xiangyu Zong, Shuilong Zhou, Honglong Li, Jiru Wang, Meng Zhang, Wenyang Wang
-
Patent number: 10293890Abstract: A flare-type tension leg floating wind turbine foundation is provided, which includes a top support platform configured to support a tower frame, a blade and a wind turbine generator set; a bottom support structure connected to a plurality of tension legs; at least three hollow upright columns connected between the top support platform and the bottom support structure and arranged around a vertical center line of the floating wind turbine foundation, each of the at least three upright columns being inclined outward from a lower end to an upper end with respect to the vertical center line of the floating wind turbine foundation; and a ballast adjusting system provided in the upright columns and/or the bottom support structure.Type: GrantFiled: February 12, 2015Date of Patent: May 21, 2019Assignee: XINJIANG GOLDWIND SCIENCE & TECHNOLOGY CO., LTD.Inventors: Rongfu Li, Jianhai Zhang, Haifei Zhu
-
Patent number: 9943875Abstract: A water valve and a drinking device are provided. The water valve includes an upper support, a lower support, a valve spool, a sealing member, a spring and a water outlet. The upper support is provided with a water inlet. The lower support is provided with a water outlet and a vent hole. The valve spool has a first end connected with the upper support and a second end fixedly connected with the lower support, and the valve spool is movable relative to the upper support, to switch on or off a communication between the water inlet and the water outlet. When the water valve is at a state of discharging water, an interior of the water outlet pipe is not communicated with atmosphere; when the water valve is at a state of not discharging water, the vent hole communicates the interior of the water outlet pipe with the atmosphere.Type: GrantFiled: November 7, 2014Date of Patent: April 17, 2018Assignees: HEFEI HUALING CO., LTD., HEFEI MIDEA REFRIGERATOR CO., LTD.Inventors: Tao Tang, Shuisheng Peng, Jianhai Zhang, Yanping Li
-
Publication number: 20170095832Abstract: A water valve and a drinking device are provided. The water valve includes an upper support, a lower support, a valve spool, a sealing member, a spring and a water outlet. The upper support is provided with a water inlet. The lower support is provided with a water outlet and a vent hole. The valve spool has a first end connected with the upper support and a second end fixedly connected with the lower support, and the valve spool is movable relative to the upper support, to switch on or off a communication between the water inlet and the water outlet. When the water valve is at a state of discharging water, an interior of the water outlet pipe is not communicated with atmosphere; when the water valve is at a state of not discharging water, the vent hole communicates the interior of the water outlet pipe with the atmosphere.Type: ApplicationFiled: November 7, 2014Publication date: April 6, 2017Inventors: Tao TANG, Shuisheng PENG, Jianhai ZHANG, Yanping LI
-
Publication number: 20160195070Abstract: A flare-type tension leg floating wind turbine foundation is provided, which includes a top support platform configured to support a tower frame, a blade and a wind turbine generator set; a bottom support structure connected to a plurality of tension legs; at least three hollow upright columns connected between the top support platform and the bottom support structure and arranged around a vertical center line of the floating wind turbine foundation, each of the at least three upright columns being inclined outward from a lower end to an upper end with respect to the vertical center line of the floating wind turbine foundation; and a ballast adjusting system provided in the upright columns and/or the bottom support structure.Type: ApplicationFiled: February 12, 2015Publication date: July 7, 2016Inventors: Rongfu LI, Jianhai ZHANG, Haifei ZHU
-
Patent number: 9127075Abstract: The present invention provides an active peptide purified from scorpions, and derivatives, analogs and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below: VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.Type: GrantFiled: July 5, 2011Date of Patent: September 8, 2015Assignee: SHENYANG PHARMACEUTICAL UNIVERSITYInventors: Jianhai Zhang, Zhou Yang, Yanfeng Liu, Chunfu Wu
-
Publication number: 20140145813Abstract: A planar high voltage transformer comprising a magnetic core, a primary winding, a secondary winding, and an insulating plate is provided, wherein the secondary winding comprises a plurality of secondary winding printed circuit boards each having a secondary coil distributed thereon.Type: ApplicationFiled: November 15, 2013Publication date: May 29, 2014Applicant: GE Medical Systems Global Technology Company, LLCInventors: Jianhai Zhang, Wei Lin, Qiang Cheng
-
Publication number: 20140144245Abstract: A curved surface shaped membrane pressure sensor for a moving member and the method for manufacturing the same, the sensor comprising an elastic curved plate and a subtype grid membrane switch formed on the curved plate, wherein the membrane switch is coupled to a cutting board shell of the moving member on one side opposed to the curved plate, and the subtype grid membrane switch is used for sensing the presence of pressure on the curved plate. The curved surface shaped membrane pressure sensor according to the present invention can not only meet the requirements on appearance of the moving member, but also effectively sense the touching to prevent injury on the object being detected, and additionally can effectively achieving the effects of fireproofing and waterproofing.Type: ApplicationFiled: November 18, 2013Publication date: May 29, 2014Applicant: GE Medical Systems Global Technology Company, LLCInventors: Jianhai Zhang, Wei Lin, Qiang Cheng
-
Publication number: 20130225500Abstract: The present invention provides an active peptide purified from scorpions, and derivatives, analogues and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below: VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.Type: ApplicationFiled: July 5, 2011Publication date: August 29, 2013Applicant: SHENYANG PHARMACEUTICAL UNIVERSITYInventors: Jianhai Zhang, Zhou Yang, Yanfeng Liu, Chunfu Wu