Abstract: The present invention relates to a rodent serum marker for prostate cancer comprising b-microseminoprotein (PSP94) and diagnostic methods thereof. The present invention also relates to a recombinant sequence to raise a ligand of a specific binding affinity to a rodent serum marker for prostate cancer, which comprises the following amino acid sequence: (SEQ ID NO: 1) MGGSHHHHHHGMASMTGGGGMGRNTRYDDDDKDRWGSWVCSIENREIFPN QMSDDCMDADGNKHFLNTPKKNCTWCSCDKTSITCCTNATPLSYDKDNCD VQFHPENCTYSVVDRKNPGKTCRVDSWTM.

Abstract: The utility of the promoter/enhancer region (i.e. regulatory region) of the PSP94 gene in targeting expression of heterologous genes, to the prostate gland was analyzed. Three breeding lines (i.e., line A, line B and line C) of the PSP-TGMAP model described herein were established with constructs containing regulatory regions with or without additional exon/intron sequence of the PSP94 gene. These regulatory regions were operatively linked to the simian virus 40 (SV40) T antigen (Tag, including both the large T and small t antigens). Histopathology evaluation of tumor grade, transgene expression, tumor responsiveness to androgen deprivation and tumor metastatic potential were analyzed and reported herein. This study indicates that regulatory regions (e.g., the promoter/enhancer with exon/intron region) of the PSP94 gene efficiently target the expression of heterologous genes to prostate tissue.