Abstract: A scent detecting apparatus detects the amount of at least one of a scented substance or a metabolite of the scented substance released from a plant, and transmits detected-amount information indicating the detected amount of at least one of the scented substance or the metabolite to a server apparatus. The server apparatus receives the detected-amount information transmitted by the scent detecting apparatus, estimates the freshness of the plant on the basis of an added amount of the scented substance indicated by stored added-amount information and on the basis of the detected amount of at least one of the scented substance or the metabolite indicated by the received detected-amount information, and transmits freshness information regarding the estimated freshness to the scent detecting apparatus. The scent detecting apparatus receives the freshness information from the server apparatus and presents the received freshness information.

Abstract: A scent imparting apparatus transmits to an information management apparatus, product information that includes added-substance information indicating a first substance that is a scented substance added to a plant and production information regarding the plant. The information management apparatus stores the received product information in a production information storage unit. A scent detecting apparatus detects a second substance that is at least one of the scented substance or a metabolite of the scented substance released from a target plant, and transmits detected-substance information indicating the second substance to the information management apparatus.

Abstract: A scent detecting apparatus detects the amount of at least one of a scented substance or a metabolite of the scented substance released from a plant, and transmits detected-amount information indicating the detected amount of at least one of the scented substance or the metabolite to a server apparatus. The server apparatus receives the detected-amount information transmitted by the scent detecting apparatus, estimates the freshness of the plant on the basis of an added amount of the scented substance indicated by stored added-amount information and on the basis of the detected amount of at least one of the scented substance or the metabolite indicated by the received detected-amount information, and transmits freshness information regarding the estimated freshness to the scent detecting apparatus. The scent detecting apparatus receives the freshness information from the server apparatus and presents the received freshness information.

Abstract: A scent imparting apparatus transmits to an information management apparatus, product information that includes added-substance information indicating a first substance that is a scented substance added to a plant and production information regarding the plant. The information management apparatus stores the received product information in a production information storage unit. A scent detecting apparatus detects a second substance that is at least one of the scented substance or a metabolite of the scented substance released from a target plant, and transmits detected-substance information indicating the second substance to the information management apparatus.

Abstract: A biometric apparatus includes a light source, an image sensor, a control circuit, and a signal processing circuit. The control circuit causes a light source to repeatedly emit a light pulse radiated onto a target part including a head of a target, causes an image sensor to receive a reflected light pulse which is caused as the light pulse is radiated onto the target part, causes the image sensor to output first image data indicating appearance of a face of the target, and causes the image sensor to output second image data according to distribution of an amount of light of at least one of components of the reflected light pulse. The signal processing circuit generates data indicating a state of the target based on a temporal change in the first image data and a temporal change in the second image data and outputs the data.

Abstract: Provided is a VHH antibody including an amino acid sequence in which at least one selected from the group consisting of glycine in position 36, arginine in position 50, and glycine in position 78, on the basis of IMGT numbering, of the amino acid sequence represented by SEQ ID NO: 1 is substituted with another amino acid. The VHH antibody according to the present disclosure is thermostable.

Abstract: Provided is a VHH antibody including an amino acid sequence in which at least one selected from the group consisting of glycine in position 36, arginine in position 50, and glycine in positon 78, on the basis of IMGT numbering, of the amino acid sequence represented by SEQ ID NO: 1 is substituted with another amino acid. The VHH antibody according to the present disclosure is thermostable.

Abstract: The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus. Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.

Abstract: The present invention provides a novel antibody capable of binding to an influenza virus. The antibody directed to the present invention consists of the amino acid sequence represented by SEQ ID NO: 15 or SEQ ID NO: 16.

Abstract: The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus. Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.

Abstract: The present invention provides a novel antibody capable of binding to an influenza virus. The antibody directed to the present invention consists of the amino acid sequence represented by SEQ ID NO: 15 or SEQ ID NO: 16.

Abstract: The object of the present invention is to provide a method for immobilizing the SpA protein on the surface of a substrate with high density without causing dimerization. The following method solves the object. That is, the method for binding a protein to a surface of a substrate, comprising steps (A) to (B): step (A) of preparing said protein to the surface, step (B) of supplying said protein to the surface, wherein said protein consists of a Protein A or at least one domain of A to E of said Protein A, and said protein comprises C-terminal modified amino acid sequence represented by SEQ ID:1(SFNRSEC).

Abstract: Provided is an immunoassay method that can reduce the effort of establishing an immunoassay system due to not needing two or more antibodies, and that is applicable to not only high molecular weight antigens but also to low molecular weight antigens such as hapten. The method is for releasing, from a surface of a base plate, immunoglobulin G antibody bound to the surface via protein A. The method includes the following steps (A) and (B): (A) a step of preparing the base plate having the surface to which immunoglobulin G antibody produced by a producer cell line of deposit No. FERM BP-10459 is bound via protein A; and (B) a step of providing a solution (from pH 6 to pH 8.9; preferably, from pH 7.4 to pH 8.9) containing human serum albumin onto the surface so as to release the immunoglobulin G antibody from the protein A.

Abstract: Provided is an immunoassay method that can reduce the effort of establishing an immunoassay system due to not needing two or more antibodies, and that is applicable to not only high molecular weight antigens but also to low molecular weight antigens such as hapten. The method is for releasing, from a surface of a base plate, immunoglobulin G antibody bound to the surface via protein A. The method includes the following steps (A) and (B): (A) a step of preparing the base plate having the surface to which immunoglobulin G antibody produced by a producer cell line of deposit No. FERM BP-10459 is bound via protein A; and (B) a step of providing a solution (from pH 6 to pH 8.9; preferably, from pH 7.4 to pH 8.9) containing human serum albumin onto the surface so as to release the immunoglobulin G antibody from the protein A.

Abstract: The object of the present invention is to provide a method for immobilizing the SpA protein on the surface of a substrate with high density without causing dimerization. The following method solves the object. That is, the method for binding a protein to a surface of a substrate, comprising steps (A) to (B): step (A) of preparing said protein to the surface, step (B) of supplying said protein to the surface, wherein said protein consists of a Protein A or at least one domain of A to E of said Protein A, and said protein comprises C-terminal modified amino acid sequence represented by SEQ ID:1(SFNRSEC).

Abstract: A measuring device (100a) includes a base body (101) constituting: a sample holding portion (102) configured to hold a test sample containing urea and a material to be detected; and a sample supply port (103) through which the test sample is supplied to the sample holding portion (102). The base body includes an optical measuring portion and a reagent holding portion (111) which are configured to carry out an optical measurement of the test sample held by the sample holding portion (102). The reagent holding portion holds an antibody to the material to be detected and urease which causes hydrolysis of the urea. With this, the present invention provides a measuring device, a measuring apparatus, and a measuring method, each having a simple configuration and capable of reducing measurement errors caused by the urea contained in the test sample and accurately measuring the material to be detected.

Abstract: A measuring device (100a) includes a base body (101) constituting: a sample holding portion (102) configured to hold a test sample containing urea and a material to be detected; and a sample supply port (103) through which the test sample is supplied to the sample holding portion (102). The base body includes an optical measuring portion and a reagent holding portion (111) which are configured to carry out an optical measurement of the test sample held by the sample holding portion (102). The reagent holding portion holds an antibody to the material to be detected and urease which causes hydrolysis of the urea. With this, the present invention provides a measuring device, a measuring apparatus, and a measuring method, each having a simple configuration and capable of reducing measurement errors caused by the urea contained in the test sample and accurately measuring the material to be detected.

Abstract: A stirring state detecting method of the present invention is a method for detecting a stirring state of a test solution by using: a sample cell (101) which holds the test solution in an internal space thereof; a stirring device (111) which stirs the test solution held in the sample cell (101); a light emitting device (106) which emits light to the test solution held in the sample cell (101); and a photoreceiver (108) which receives the light, and includes the steps of: (A) in a state in which the test solution is held in the sample cell (100), activating the stirring device (111) to change a liquid level (102) of the test solution by stirring; (B) emitting the light from the light emitting device (106) to the test solution held in the sample cell (100); (C) detecting by the photoreceiver (108) an amount of the light which is emitted to the test solution and subjected to an action of the test solution whose liquid level (102) is changed by the stirring; and (D) determining the stirring state of the test solut