Abstract: A wireless communication method, a terminal device and a network device are provided. A terminal device transmits first information to a network device, the first information indicating a parameter the terminal device expects the network device to configure for a Multimedia Broadcast Multicast Service (MBMS) transmission. The terminal device reports an expected parameter for transmitting an MBMS service, such that the network device can provide the MBMS service based on the expected parameter of the terminal device, which is beneficial to meet the service requirements of the terminal device.

Abstract: Disclosed are a device of complex gas mixture detection based on optical-path-adjustable spectrum detection and a method therefor, and the device includes: a light source configured for generating an incident beam and emitting the incident beam into an optical gas cell; the optical gas cell, including a cavity configured for accommodating a gas sample, and a reflection module group configured for reflecting the incident beam and a track arranged in the cavity, where the track is consistent with a light path of the light beam in the cavity; a detector module that is connected with the track in a relatively movable manner and is configured for receiving light beams and obtaining spectral data, where an optical path is changed by moving the detector module relative to the track; and a data acquisition unit that is configured for acquiring the spectral data obtained by the detector module.

Abstract: The invention belongs to the field of drug synthesis, the invention discloses a synthetic method and application of diltiazem hydrochloride. The synthesis method is through the condensation ring closing and esterification of cis-(2S,3S) compound 1 and compound 2, then add hydrochloric acid to form salt, get the diltiazem hydrochloride. The invention has the following advantages, shortens the synthesis steps, improves the reaction yield, reduces the industrial production cost, and saves the time cost of the synthesis. The method is used for the synthesis of diltiazem hydrochloride, and the synthesized diltiazem hydrochloride is used to prepare diltiazem hydrochloride for injection.

Abstract: Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X1 is selected from Y or F, and X2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.

Abstract: The present application discloses a method for early warning brandish of a transmission wire based on an improved Bayes-Adaboost algorithm, including: forming a classifier by training a historical brandish fault training set, and by using an Adaboost ensemble learning method, and obtaining an early warning result of the brandish of the transmission wire via the classifier according to real-time forecast meteorological information and information of different parameters of the transmission wire. The present invention can realize calculation and processing of forecast information of meteorological characteristic factors of the brandish of the transmission wire, structural parameters of the transmission wire and other related data, and obtain an early warning analysis result of a brandish disaster of the transmission wire in a region.

Abstract: A ground extraction method for 3D point clouds of outdoor scenes based on Gaussian process regression, including: (1) obtaining the 3D point cloud of an outdoor scene, (2) building the neighborhood of the 3D point cloud, (3) calculating the covariance matrices and normal vectors of the 3D point cloud, (4) classifying the 3D point cloud according to its neighborhood shape, (5) extracting the initial ground Gs, (6) segmenting the initial ground, (7) 2D Gaussian process regression, (8) finding the neighborhood NLGk of each ground fragment LGk, and (9) extracting the final ground Ge.

Abstract: Disclosed is a method of recovering rare earth, aluminum and silicon from rare earth-containing aluminum-silicon scrap. The method comprises: S1, acid-leaching the rare earth-containing aluminum-silicon scrap with an inorganic acid aqueous solution to obtain a silicon-rich slag and acid leached solution containing rare earth and aluminum element; S2, adding an alkaline substance into the acid leached solution containing the rare earth and aluminum element and controlling a PH value of the acid leaching solution between 3.5 to 5.2, performing a solid-liquid separation to obtain a aluminum hydroxide-containing precipitate and a rare earth-containing solution filter; S3, reacting the aluminum hydroxide containing precipitate with sodium hydroxide to obtain sodium metaaluminate solution and aluminum-silicon slag, and preparing a rare earth compound product with the rare earth-containing filtrate.

Abstract: The disclosure discloses isolated polynucleotides and polypeptides, and recombinant DNA constructs useful for conferring improved tolerance in plants to insect pests; compositions (such as plants or seeds) comprising these recombinant DNA constructs; and methods utilizing these recombinant DNA constructs. The recombinant DNA constructs comprise a polynucleotide operably linked to a promoter that is functional in a plant, wherein said polynucleotides encode insect tolerance polypeptides.

Abstract: Disclosed is a method of recovering rare earth, aluminum and silicon from rare earth-containing aluminum-silicon scrap. The method comprises: S1, acid-leaching the rare earth-containing aluminum-silicon scrap with an inorganic acid aqueous solution to obtain a silicon-rich slag and acid leached solution containing rare earth and aluminum element; S2, adding an alkaline substance into the acid leached solution containing the rare earth and aluminum element and controlling a PH value of the acid leaching solution between 3.5 to 5.2, performing a solid-liquid separation to obtain a aluminum hydroxide-containing precipitate and a rare earth-containing solution filter; S3, reacting the aluminum hydroxide containing precipitate with sodium hydroxidee to obtain sodium metaaluminate solution and aluminum-silicon slag, and preparing a rare earth compound product with the rare earth-containing filtrate.

Abstract: Techniques for implementing a scalable DOM and a pluggable DOM are provided. A scalable DOM implementation manages a DOM tree in memory to free unreferenced nodes, avoid generating nodes unnecessarily, and avoid storing multiple versions of the same data on disk. A pluggable DOM implementation includes an abstract interface that is defined between the API layer and the data layer of a DOM implementation. An implementation of the abstract interface is defined for each data source that is plugged in to the pluggable DOM implementation and that stores XML data in a different format.

Abstract: An XML Extractor that extracts XML data from streamed input based on registered XPaths is provided. XPaths and associated content handlers instances are registered at runtime with the XML Extractor. The XML Extractor receives streaming input that represents XML data at a stream-based parser, and evaluates the received input against the registered XPaths expression. In response to detecting that the received streaming input includes an XPath that matches a registered XPath expression, the XML Extractor generates output to the content handler associated with the matching registered XPath expression.

Abstract: Techniques for implementing a scalable DOM and a pluggable DOM are provided. A scalable DOM implementation manages a DOM tree in memory to free unreferenced nodes, avoid generating nodes unnecessarily, and avoid storing multiple versions of the same data on disk. A pluggable DOM implementation includes an abstract interface that is defined between the API layer and the data layer of a DOM implementation. An implementation of the abstract interface is defined for each data source that is plugged in to the pluggable DOM implementation and that stores XML data in a different format.

Abstract: Techniques for implementing a schema-aware mid-tier binary XML are provided. Token vocabularies are stored in a repository that is accessible to mid-tier applications from separate database systems. The token vocabularies are thus shared among the mid-tier applications of each database system. The repository may be part of a file system or database that is separate from any of the database systems, or the repository may be part of one of the database systems.

Abstract: An XML processing model enables applications that use an XML stream to perform metadata-based or other processing of data during a data validation operation while preserving a streaming processing model. For example, while an XML node is being validated, requests can be received regarding the status of the validation and any processing that may be required with the node in order to conform it to requirements of an external application. A validator exposes public APIs that allow such validation-time requests from an event handler that is associated with an external application and that is registered with the XML stream. Messages that identify schema annotation definitions are provided to an external application to direct the type of processing to be performed on nodes at application runtime. Thus, applications can process a node according to the annotation definition concurrently with validation of the given node by the validator.

Abstract: Techniques for implementing a schema-aware mid-tier binary XML are provided. Token vocabularies are stored in a repository that is accessible to mid-tier applications from separate database systems. The token vocabularies are thus shared among the mid-tier applications of each database system. The repository may be part of a file system or database that is separate from any of the database systems, or the repository may be part of one of the database systems.

Abstract: Techniques for implementing a scalable DOM and a pluggable DOM are provided. A scalable DOM implementation manages a DOM tree in memory to free unreferenced nodes, avoid generating nodes unnecessarily, and avoid storing multiple versions of the same data on disk. A pluggable DOM implementation includes an abstract interface that is defined between the API layer and the data layer of a DOM implementation. An implementation of the abstract interface is defined for each data source that is plugged in to the pluggable DOM implementation and that stores XML data in a different format.

Abstract: Techniques for implementing a scalable DOM and a pluggable DOM are provided. A scalable DOM implementation manages a DOM tree in memory to free unreferenced nodes, avoid generating nodes unnecessarily, and avoid storing multiple versions of the same data on disk. A pluggable DOM implementation includes an abstract interface that is defined between the API layer and the data layer of a DOM implementation. An implementation of the abstract interface is defined for each data source that is plugged in to the pluggable DOM implementation and that stores XML data in a different format.

Abstract: An XML Extractor that extracts XML data from streamed input based on registered XPaths. XPaths and associated content handlers instances are registered at runtime with the XML Extractor. The XML receives streaming input that represents XML data at a stream-based parser, and evaluates the received input against the registered XPaths expression. In response to detecting that the received streaming input includes an XPath that matches a registered XPath expression, generating output to the content handler associated with the matching registered XPath expression.

Abstract: An XML processing model enables applications that use an XML stream to perform metadata-based or other processing of data during a data validation operation while preserving a streaming processing model. For example, while an XML node is being validated, requests can be received regarding the status of the validation and any processing that may be required with the node in order to conform it to requirements of an external application. A validator exposes public APIs that allow such validation-time requests from an event handler that is associated with an external application and that is registered with the XML stream. Messages that identify schema annotation definitions are provided to an external application to direct the type of processing to be performed on nodes at application runtime. Thus, applications can process a node according to the annotation definition concurrently with validation of the given node by the validator.