Patents by Inventor Jinyu Wang
Jinyu Wang has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).
-
Publication number: 20250108019Abstract: The present invention relates to regulation and promotion of body tissue growth, regeneration and healing by lactic acid or polylactic acid, and provides a novel method for preventing and treating tissue injury, which can be used for tissue injury repair, and has a broad application prospect in the aspects of tissue or organ defect treatment and repair and the like.Type: ApplicationFiled: July 26, 2022Publication date: April 3, 2025Inventors: Jinyue WANG, Qian ZHENG
-
DILTIAZEM HYDROCHLORIDE AND PREGABALIN COMPOSITION, METHOD FOR PREPARING THE SAME, AND USAGE THEREOF
Publication number: 20240252459Abstract: A diltiazem hydrochloride and pregabalin composition and a preparation method thereof and its application. The composition of the invention is a lyophilizing agent prepared by adding an adequate amount of pregabalin hydrochloride solution, adding excipient and stirring until transparent. The lyophilizing agent will not produce crystallization after dissolution. In addition, by combining proper amount of pregabalin with sufficient amount of diltiazem hydrochloride into an injection, the efficacy of the original diltiazem hydrochloride can be guaranteed, and the adverse reactions such as dyspnea, spasm, skin itching and urticaria can be prevented or reduced.Type: ApplicationFiled: May 12, 2021Publication date: August 1, 2024Inventors: Yuena Huang, Xiaofang Wang, Jinyu Wang, Shuhua Pan, Shouchun Wang -
Publication number: 20230234932Abstract: The invention belongs to the field of drug synthesis, the invention discloses a synthetic method and application of diltiazem hydrochloride. The synthesis method is through the condensation ring closing and esterification of cis-(2S,3S) compound 1 and compound 2, then add hydrochloric acid to form salt, get the diltiazem hydrochloride. The invention has the following advantages, shortens the synthesis steps, improves the reaction yield, reduces the industrial production cost, and saves the time cost of the synthesis. The method is used for the synthesis of diltiazem hydrochloride, and the synthesized diltiazem hydrochloride is used to prepare diltiazem hydrochloride for injection.Type: ApplicationFiled: September 14, 2021Publication date: July 27, 2023Inventors: Shuhua PAN, Jinyu WANG, Shouchun WANG
-
Publication number: 20230192865Abstract: Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X1 is selected from Y or F, and X2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.Type: ApplicationFiled: May 6, 2020Publication date: June 22, 2023Inventors: Zhe SONG, Youlin QI, Yaobin QIN, Jianfeng YANG, Limin HOU, Zhiwei ZHU, Qiuping DONG, Xianggan LI, Lei ZHANG, Jinyu WANG, Yuejin LI
-
Publication number: 20220383165Abstract: The present application discloses a method for early warning brandish of a transmission wire based on an improved Bayes-Adaboost algorithm, including: forming a classifier by training a historical brandish fault training set, and by using an Adaboost ensemble learning method, and obtaining an early warning result of the brandish of the transmission wire via the classifier according to real-time forecast meteorological information and information of different parameters of the transmission wire. The present invention can realize calculation and processing of forecast information of meteorological characteristic factors of the brandish of the transmission wire, structural parameters of the transmission wire and other related data, and obtain an early warning analysis result of a brandish disaster of the transmission wire in a region.Type: ApplicationFiled: May 18, 2022Publication date: December 1, 2022Inventors: Degui Yao, Ning Zhou, Zhimin Guo, Lei Wang, Ming Lu, Zhe Li, Wei Zheng, Shanfeng Liu, Xiaolei Li, Jinyu Wang, Yun Liang, Chao Wang, Bo Zhang, Yupeng Zhang, Shaoguang Yuan, Yangyang Tian, Wandeng Mao, Xiaofei Zhang
-
Publication number: 20220051052Abstract: A ground extraction method for 3D point clouds of outdoor scenes based on Gaussian process regression, including: (1) obtaining the 3D point cloud of an outdoor scene, (2) building the neighborhood of the 3D point cloud, (3) calculating the covariance matrices and normal vectors of the 3D point cloud, (4) classifying the 3D point cloud according to its neighborhood shape, (5) extracting the initial ground Gs, (6) segmenting the initial ground, (7) 2D Gaussian process regression, (8) finding the neighborhood NLGk of each ground fragment LGk, and (9) extracting the final ground Ge.Type: ApplicationFiled: October 28, 2021Publication date: February 17, 2022Inventors: Yi An, Wusong Liu, Xiusheng Li, Jinyu Wang, Lei Wang
-
Patent number: 10280482Abstract: Disclosed is a method of recovering rare earth, aluminum and silicon from rare earth-containing aluminum-silicon scrap. The method comprises: S1, acid-leaching the rare earth-containing aluminum-silicon scrap with an inorganic acid aqueous solution to obtain a silicon-rich slag and acid leached solution containing rare earth and aluminum element; S2, adding an alkaline substance into the acid leached solution containing the rare earth and aluminum element and controlling a PH value of the acid leaching solution between 3.5 to 5.2, performing a solid-liquid separation to obtain a aluminum hydroxide-containing precipitate and a rare earth-containing solution filter; S3, reacting the aluminum hydroxide containing precipitate with sodium hydroxide to obtain sodium metaaluminate solution and aluminum-silicon slag, and preparing a rare earth compound product with the rare earth-containing filtrate.Type: GrantFiled: June 16, 2016Date of Patent: May 7, 2019Assignee: GRIREM ADVANCED MATERIALS CO., LTD.Inventors: Xiaowei Huang, Yang Xu, Jinyu Wang, Liangshi Wang, Zongyu Feng, Dali Cui, Zhiqi Long, Xu Sun, Na Zhao
-
Publication number: 20190040412Abstract: The disclosure discloses isolated polynucleotides and polypeptides, and recombinant DNA constructs useful for conferring improved tolerance in plants to insect pests; compositions (such as plants or seeds) comprising these recombinant DNA constructs; and methods utilizing these recombinant DNA constructs. The recombinant DNA constructs comprise a polynucleotide operably linked to a promoter that is functional in a plant, wherein said polynucleotides encode insect tolerance polypeptides.Type: ApplicationFiled: January 19, 2017Publication date: February 7, 2019Applicants: SINOBIOWAY BIO-AGRICULTURE GROUP CO. LTD., PIONEER OVERSEAS CORPORATIONInventors: HUITING LI, GUIHUA LU, GUANFAN MAO, GUOKUI WANG, JINYU WANG
-
Publication number: 20180363098Abstract: Disclosed is a method of recovering rare earth, aluminum and silicon from rare earth-containing aluminum-silicon scrap. The method comprises: S1, acid-leaching the rare earth-containing aluminum-silicon scrap with an inorganic acid aqueous solution to obtain a silicon-rich slag and acid leached solution containing rare earth and aluminum element; S2, adding an alkaline substance into the acid leached solution containing the rare earth and aluminum element and controlling a PH value of the acid leaching solution between 3.5 to 5.2, performing a solid-liquid separation to obtain a aluminum hydroxide-containing precipitate and a rare earth-containing solution filter; S3, reacting the aluminum hydroxide containing precipitate with sodium hydroxidee to obtain sodium metaaluminate solution and aluminum-silicon slag, and preparing a rare earth compound product with the rare earth-containing filtrate.Type: ApplicationFiled: June 16, 2016Publication date: December 20, 2018Inventors: Xiaowei Huang, Yang Xu, Jinyu Wang, Liangshi Wang, Zongyu Feng, Dali Cui, Zhiqi Long, Xu Sun, Na Zhao
-
Patent number: 8156494Abstract: Techniques for implementing a scalable DOM and a pluggable DOM are provided. A scalable DOM implementation manages a DOM tree in memory to free unreferenced nodes, avoid generating nodes unnecessarily, and avoid storing multiple versions of the same data on disk. A pluggable DOM implementation includes an abstract interface that is defined between the API layer and the data layer of a DOM implementation. An implementation of the abstract interface is defined for each data source that is plugged in to the pluggable DOM implementation and that stores XML data in a different format.Type: GrantFiled: July 13, 2007Date of Patent: April 10, 2012Assignee: Oracle International CorporationInventors: Kongyi Zhou, K. Karun, Jinyu Wang, Tim Yu
-
Patent number: 7877366Abstract: An XML Extractor that extracts XML data from streamed input based on registered XPaths is provided. XPaths and associated content handlers instances are registered at runtime with the XML Extractor. The XML Extractor receives streaming input that represents XML data at a stream-based parser, and evaluates the received input against the registered XPaths expression. In response to detecting that the received streaming input includes an XPath that matches a registered XPath expression, the XML Extractor generates output to the content handler associated with the matching registered XPath expression.Type: GrantFiled: March 14, 2005Date of Patent: January 25, 2011Assignee: Oracle International CorporationInventors: Jinyu Wang, Mark Vincent Scardina, Kongyi Zhou
-
Patent number: 7844632Abstract: Techniques for implementing a scalable DOM and a pluggable DOM are provided. A scalable DOM implementation manages a DOM tree in memory to free unreferenced nodes, avoid generating nodes unnecessarily, and avoid storing multiple versions of the same data on disk. A pluggable DOM implementation includes an abstract interface that is defined between the API layer and the data layer of a DOM implementation. An implementation of the abstract interface is defined for each data source that is plugged in to the pluggable DOM implementation and that stores XML data in a different format.Type: GrantFiled: July 13, 2007Date of Patent: November 30, 2010Assignee: Oracle International CorporationInventors: Kongyi Zhou, K. Karun, Jinyu Wang, Tim Yu
-
Patent number: 7756906Abstract: Techniques for implementing a schema-aware mid-tier binary XML are provided. Token vocabularies are stored in a repository that is accessible to mid-tier applications from separate database systems. The token vocabularies are thus shared among the mid-tier applications of each database system. The repository may be part of a file system or database that is separate from any of the database systems, or the repository may be part of one of the database systems.Type: GrantFiled: July 13, 2007Date of Patent: July 13, 2010Assignee: Oracle International CorporationInventors: Meghna Mehta, Yuhuan (Bill) Han, Jinyu Wang, K. Karun, Anguel Novoselsky, Tim Yu, Kongyi Zhou
-
Patent number: 7587667Abstract: An XML processing model enables applications that use an XML stream to perform metadata-based or other processing of data during a data validation operation while preserving a streaming processing model. For example, while an XML node is being validated, requests can be received regarding the status of the validation and any processing that may be required with the node in order to conform it to requirements of an external application. A validator exposes public APIs that allow such validation-time requests from an event handler that is associated with an external application and that is registered with the XML stream. Messages that identify schema annotation definitions are provided to an external application to direct the type of processing to be performed on nodes at application runtime. Thus, applications can process a node according to the annotation definition concurrently with validation of the given node by the validator.Type: GrantFiled: March 10, 2004Date of Patent: September 8, 2009Assignee: Oracle International CorporationInventors: Mark Vincent Scardina, Jinyu Wang, K Karun, Kongyi Zhou, Benjamin Chang
-
Publication number: 20080098412Abstract: Techniques for implementing a scalable DOM and a pluggable DOM are provided. A scalable DOM implementation manages a DOM tree in memory to free unreferenced nodes, avoid generating nodes unnecessarily, and avoid storing multiple versions of the same data on disk. A pluggable DOM implementation includes an abstract interface that is defined between the API layer and the data layer of a DOM implementation. An implementation of the abstract interface is defined for each data source that is plugged in to the pluggable DOM implementation and that stores XML data in a different format.Type: ApplicationFiled: July 13, 2007Publication date: April 24, 2008Inventors: Kongyi Zhou, K. Karun, Jinyu Wang, Tim Yu
-
Publication number: 20080098186Abstract: Techniques for implementing a scalable DOM and a pluggable DOM are provided. A scalable DOM implementation manages a DOM tree in memory to free unreferenced nodes, avoid generating nodes unnecessarily, and avoid storing multiple versions of the same data on disk. A pluggable DOM implementation includes an abstract interface that is defined between the API layer and the data layer of a DOM implementation. An implementation of the abstract interface is defined for each data source that is plugged in to the pluggable DOM implementation and that stores XML data in a different format.Type: ApplicationFiled: July 13, 2007Publication date: April 24, 2008Inventors: Kongyi Zhou, K. Karun, Jinyu Wang, Tim Yu
-
Publication number: 20080098002Abstract: Techniques for implementing a schema-aware mid-tier binary XML are provided. Token vocabularies are stored in a repository that is accessible to mid-tier applications from separate database systems. The token vocabularies are thus shared among the mid-tier applications of each database system. The repository may be part of a file system or database that is separate from any of the database systems, or the repository may be part of one of the database systems.Type: ApplicationFiled: July 13, 2007Publication date: April 24, 2008Inventors: Meghna Mehta, Yuhuan (Bill) Han, Jinyu Wang, K. Karun, Anguel Novoselsky, Tim Yu, Kongyi Zhou
-
Publication number: 20050203957Abstract: An XML Extractor that extracts XML data from streamed input based on registered XPaths. XPaths and associated content handlers instances are registered at runtime with the XML Extractor. The XML receives streaming input that represents XML data at a stream-based parser, and evaluates the received input against the registered XPaths expression. In response to detecting that the received streaming input includes an XPath that matches a registered XPath expression, generating output to the content handler associated with the matching registered XPath expression.Type: ApplicationFiled: March 14, 2005Publication date: September 15, 2005Applicant: ORACLE INTERNATIONAL CORPORATIONInventors: Jinyu Wang, Mark Scardina, Kongyi Zhou
-
Publication number: 20050055631Abstract: An XML processing model enables applications that use an XML stream to perform metadata-based or other processing of data during a data validation operation while preserving a streaming processing model. For example, while an XML node is being validated, requests can be received regarding the status of the validation and any processing that may be required with the node in order to conform it to requirements of an external application. A validator exposes public APIs that allow such validation-time requests from an event handler that is associated with an external application and that is registered with the XML stream. Messages that identify schema annotation definitions are provided to an external application to direct the type of processing to be performed on nodes at application runtime. Thus, applications can process a node according to the annotation definition concurrently with validation of the given node by the validator.Type: ApplicationFiled: March 10, 2004Publication date: March 10, 2005Applicant: ORACLE INTERNATIONAL CORPORATIONInventors: Mark Scardina, Jinyu Wang, K Karun, Kongyi Zhou, Benjamin Chang
-
Patent number: D1001279Type: GrantFiled: June 7, 2022Date of Patent: October 10, 2023Inventors: Tingjia Chen, Jinyu Wang, Jing Lyu