Patents by Inventor Jinyu Wang

Jinyu Wang has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20260243920
    Abstract: A method for identifying icing zones of typical micro-terrain and micro-climate on transmission lines, including: Step 1, generating a DEM map with a range of 1.5 km×1.5 km centered on the tower's latitude and longitude; Step 2, filtering the DEM map; Step 3, extracting typical terrain feature factors of the icing zone using the maximum gradient algorithm based on the DEM map obtained in Step 2; Step 4, performing basic calculations based on the terrain feature factors in Step 3; Step 5, analyzing the terrain features to propose quantitative values applicable to each micro-terrain and micro-climate zone, determining whether there are high mountain watersheds, terrain uplift, mountain passes, canyon wind corridors, and increased water vapor; thus solving the problem of identifying icing conditions in different types of micro-terrain and micro-climate transmission lines.
    Type: Application
    Filed: April 9, 2026
    Publication date: August 20, 2026
    Applicants: State Grid Henan Electric Power Research institute, Chongqing Dige Technology Co., Ltd.
    Inventors: Degui Yao, Jinyu Wang, Xingliang Jiang, Zhe Li, Guolin Yang, Jiaying Ke, Lina Dong, Yun Liang, Lu Zhang, Kai Pang, Chao Wang, Ming Lu, Sikun Yuan, Yang Gao, Shuai Li, Jingjing Cui, Zhuojun Li
  • Patent number: 12536455
    Abstract: The present application discloses a method for early warning brandish of a transmission wire based on an improved Bayes-Adaboost algorithm, including: forming a classifier by training a historical brandish fault training set, and by using an Adaboost ensemble learning method, and obtaining an early warning result of the brandish of the transmission wire via the classifier according to real-time forecast meteorological information and information of different parameters of the transmission wire. The present invention can realize calculation and processing of forecast information of meteorological characteristic factors of the brandish of the transmission wire, structural parameters of the transmission wire and other related data, and obtain an early warning analysis result of a brandish disaster of the transmission wire in a region.
    Type: Grant
    Filed: May 18, 2022
    Date of Patent: January 27, 2026
    Assignees: State Grid Henan Electric Power Company Electric Power Science Research Institute, State Grid Henan Electric Power Company, State Grid Corporation of China
    Inventors: Degui Yao, Ning Zhou, Zhimin Guo, Lei Wang, Ming Lu, Zhe Li, Wei Zheng, Shanfeng Liu, Xiaolei Li, Jinyu Wang, Yun Liang, Chao Wang, Bo Zhang, Yupeng Zhang, Shaoguang Yuan, Yangyang Tian, Wandeng Mao, Xiaofei Zhang
  • Publication number: 20240252459
    Abstract: A diltiazem hydrochloride and pregabalin composition and a preparation method thereof and its application. The composition of the invention is a lyophilizing agent prepared by adding an adequate amount of pregabalin hydrochloride solution, adding excipient and stirring until transparent. The lyophilizing agent will not produce crystallization after dissolution. In addition, by combining proper amount of pregabalin with sufficient amount of diltiazem hydrochloride into an injection, the efficacy of the original diltiazem hydrochloride can be guaranteed, and the adverse reactions such as dyspnea, spasm, skin itching and urticaria can be prevented or reduced.
    Type: Application
    Filed: May 12, 2021
    Publication date: August 1, 2024
    Inventors: Yuena Huang, Xiaofang Wang, Jinyu Wang, Shuhua Pan, Shouchun Wang
  • Publication number: 20230234932
    Abstract: The invention belongs to the field of drug synthesis, the invention discloses a synthetic method and application of diltiazem hydrochloride. The synthesis method is through the condensation ring closing and esterification of cis-(2S,3S) compound 1 and compound 2, then add hydrochloric acid to form salt, get the diltiazem hydrochloride. The invention has the following advantages, shortens the synthesis steps, improves the reaction yield, reduces the industrial production cost, and saves the time cost of the synthesis. The method is used for the synthesis of diltiazem hydrochloride, and the synthesized diltiazem hydrochloride is used to prepare diltiazem hydrochloride for injection.
    Type: Application
    Filed: September 14, 2021
    Publication date: July 27, 2023
    Inventors: Shuhua PAN, Jinyu WANG, Shouchun WANG
  • Publication number: 20230192865
    Abstract: Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X1 is selected from Y or F, and X2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.
    Type: Application
    Filed: May 6, 2020
    Publication date: June 22, 2023
    Inventors: Zhe SONG, Youlin QI, Yaobin QIN, Jianfeng YANG, Limin HOU, Zhiwei ZHU, Qiuping DONG, Xianggan LI, Lei ZHANG, Jinyu WANG, Yuejin LI
  • Publication number: 20220383165
    Abstract: The present application discloses a method for early warning brandish of a transmission wire based on an improved Bayes-Adaboost algorithm, including: forming a classifier by training a historical brandish fault training set, and by using an Adaboost ensemble learning method, and obtaining an early warning result of the brandish of the transmission wire via the classifier according to real-time forecast meteorological information and information of different parameters of the transmission wire. The present invention can realize calculation and processing of forecast information of meteorological characteristic factors of the brandish of the transmission wire, structural parameters of the transmission wire and other related data, and obtain an early warning analysis result of a brandish disaster of the transmission wire in a region.
    Type: Application
    Filed: May 18, 2022
    Publication date: December 1, 2022
    Inventors: Degui Yao, Ning Zhou, Zhimin Guo, Lei Wang, Ming Lu, Zhe Li, Wei Zheng, Shanfeng Liu, Xiaolei Li, Jinyu Wang, Yun Liang, Chao Wang, Bo Zhang, Yupeng Zhang, Shaoguang Yuan, Yangyang Tian, Wandeng Mao, Xiaofei Zhang
  • Publication number: 20220051052
    Abstract: A ground extraction method for 3D point clouds of outdoor scenes based on Gaussian process regression, including: (1) obtaining the 3D point cloud of an outdoor scene, (2) building the neighborhood of the 3D point cloud, (3) calculating the covariance matrices and normal vectors of the 3D point cloud, (4) classifying the 3D point cloud according to its neighborhood shape, (5) extracting the initial ground Gs, (6) segmenting the initial ground, (7) 2D Gaussian process regression, (8) finding the neighborhood NLGk of each ground fragment LGk, and (9) extracting the final ground Ge.
    Type: Application
    Filed: October 28, 2021
    Publication date: February 17, 2022
    Inventors: Yi An, Wusong Liu, Xiusheng Li, Jinyu Wang, Lei Wang
  • Patent number: 10280482
    Abstract: Disclosed is a method of recovering rare earth, aluminum and silicon from rare earth-containing aluminum-silicon scrap. The method comprises: S1, acid-leaching the rare earth-containing aluminum-silicon scrap with an inorganic acid aqueous solution to obtain a silicon-rich slag and acid leached solution containing rare earth and aluminum element; S2, adding an alkaline substance into the acid leached solution containing the rare earth and aluminum element and controlling a PH value of the acid leaching solution between 3.5 to 5.2, performing a solid-liquid separation to obtain a aluminum hydroxide-containing precipitate and a rare earth-containing solution filter; S3, reacting the aluminum hydroxide containing precipitate with sodium hydroxide to obtain sodium metaaluminate solution and aluminum-silicon slag, and preparing a rare earth compound product with the rare earth-containing filtrate.
    Type: Grant
    Filed: June 16, 2016
    Date of Patent: May 7, 2019
    Assignee: GRIREM ADVANCED MATERIALS CO., LTD.
    Inventors: Xiaowei Huang, Yang Xu, Jinyu Wang, Liangshi Wang, Zongyu Feng, Dali Cui, Zhiqi Long, Xu Sun, Na Zhao
  • Publication number: 20190040412
    Abstract: The disclosure discloses isolated polynucleotides and polypeptides, and recombinant DNA constructs useful for conferring improved tolerance in plants to insect pests; compositions (such as plants or seeds) comprising these recombinant DNA constructs; and methods utilizing these recombinant DNA constructs. The recombinant DNA constructs comprise a polynucleotide operably linked to a promoter that is functional in a plant, wherein said polynucleotides encode insect tolerance polypeptides.
    Type: Application
    Filed: January 19, 2017
    Publication date: February 7, 2019
    Applicants: SINOBIOWAY BIO-AGRICULTURE GROUP CO. LTD., PIONEER OVERSEAS CORPORATION
    Inventors: HUITING LI, GUIHUA LU, GUANFAN MAO, GUOKUI WANG, JINYU WANG
  • Publication number: 20180363098
    Abstract: Disclosed is a method of recovering rare earth, aluminum and silicon from rare earth-containing aluminum-silicon scrap. The method comprises: S1, acid-leaching the rare earth-containing aluminum-silicon scrap with an inorganic acid aqueous solution to obtain a silicon-rich slag and acid leached solution containing rare earth and aluminum element; S2, adding an alkaline substance into the acid leached solution containing the rare earth and aluminum element and controlling a PH value of the acid leaching solution between 3.5 to 5.2, performing a solid-liquid separation to obtain a aluminum hydroxide-containing precipitate and a rare earth-containing solution filter; S3, reacting the aluminum hydroxide containing precipitate with sodium hydroxidee to obtain sodium metaaluminate solution and aluminum-silicon slag, and preparing a rare earth compound product with the rare earth-containing filtrate.
    Type: Application
    Filed: June 16, 2016
    Publication date: December 20, 2018
    Inventors: Xiaowei Huang, Yang Xu, Jinyu Wang, Liangshi Wang, Zongyu Feng, Dali Cui, Zhiqi Long, Xu Sun, Na Zhao
  • Patent number: 8156494
    Abstract: Techniques for implementing a scalable DOM and a pluggable DOM are provided. A scalable DOM implementation manages a DOM tree in memory to free unreferenced nodes, avoid generating nodes unnecessarily, and avoid storing multiple versions of the same data on disk. A pluggable DOM implementation includes an abstract interface that is defined between the API layer and the data layer of a DOM implementation. An implementation of the abstract interface is defined for each data source that is plugged in to the pluggable DOM implementation and that stores XML data in a different format.
    Type: Grant
    Filed: July 13, 2007
    Date of Patent: April 10, 2012
    Assignee: Oracle International Corporation
    Inventors: Kongyi Zhou, K. Karun, Jinyu Wang, Tim Yu
  • Patent number: 7877366
    Abstract: An XML Extractor that extracts XML data from streamed input based on registered XPaths is provided. XPaths and associated content handlers instances are registered at runtime with the XML Extractor. The XML Extractor receives streaming input that represents XML data at a stream-based parser, and evaluates the received input against the registered XPaths expression. In response to detecting that the received streaming input includes an XPath that matches a registered XPath expression, the XML Extractor generates output to the content handler associated with the matching registered XPath expression.
    Type: Grant
    Filed: March 14, 2005
    Date of Patent: January 25, 2011
    Assignee: Oracle International Corporation
    Inventors: Jinyu Wang, Mark Vincent Scardina, Kongyi Zhou
  • Patent number: 7844632
    Abstract: Techniques for implementing a scalable DOM and a pluggable DOM are provided. A scalable DOM implementation manages a DOM tree in memory to free unreferenced nodes, avoid generating nodes unnecessarily, and avoid storing multiple versions of the same data on disk. A pluggable DOM implementation includes an abstract interface that is defined between the API layer and the data layer of a DOM implementation. An implementation of the abstract interface is defined for each data source that is plugged in to the pluggable DOM implementation and that stores XML data in a different format.
    Type: Grant
    Filed: July 13, 2007
    Date of Patent: November 30, 2010
    Assignee: Oracle International Corporation
    Inventors: Kongyi Zhou, K. Karun, Jinyu Wang, Tim Yu
  • Patent number: 7756906
    Abstract: Techniques for implementing a schema-aware mid-tier binary XML are provided. Token vocabularies are stored in a repository that is accessible to mid-tier applications from separate database systems. The token vocabularies are thus shared among the mid-tier applications of each database system. The repository may be part of a file system or database that is separate from any of the database systems, or the repository may be part of one of the database systems.
    Type: Grant
    Filed: July 13, 2007
    Date of Patent: July 13, 2010
    Assignee: Oracle International Corporation
    Inventors: Meghna Mehta, Yuhuan (Bill) Han, Jinyu Wang, K. Karun, Anguel Novoselsky, Tim Yu, Kongyi Zhou
  • Patent number: 7587667
    Abstract: An XML processing model enables applications that use an XML stream to perform metadata-based or other processing of data during a data validation operation while preserving a streaming processing model. For example, while an XML node is being validated, requests can be received regarding the status of the validation and any processing that may be required with the node in order to conform it to requirements of an external application. A validator exposes public APIs that allow such validation-time requests from an event handler that is associated with an external application and that is registered with the XML stream. Messages that identify schema annotation definitions are provided to an external application to direct the type of processing to be performed on nodes at application runtime. Thus, applications can process a node according to the annotation definition concurrently with validation of the given node by the validator.
    Type: Grant
    Filed: March 10, 2004
    Date of Patent: September 8, 2009
    Assignee: Oracle International Corporation
    Inventors: Mark Vincent Scardina, Jinyu Wang, K Karun, Kongyi Zhou, Benjamin Chang
  • Publication number: 20080098412
    Abstract: Techniques for implementing a scalable DOM and a pluggable DOM are provided. A scalable DOM implementation manages a DOM tree in memory to free unreferenced nodes, avoid generating nodes unnecessarily, and avoid storing multiple versions of the same data on disk. A pluggable DOM implementation includes an abstract interface that is defined between the API layer and the data layer of a DOM implementation. An implementation of the abstract interface is defined for each data source that is plugged in to the pluggable DOM implementation and that stores XML data in a different format.
    Type: Application
    Filed: July 13, 2007
    Publication date: April 24, 2008
    Inventors: Kongyi Zhou, K. Karun, Jinyu Wang, Tim Yu
  • Publication number: 20080098002
    Abstract: Techniques for implementing a schema-aware mid-tier binary XML are provided. Token vocabularies are stored in a repository that is accessible to mid-tier applications from separate database systems. The token vocabularies are thus shared among the mid-tier applications of each database system. The repository may be part of a file system or database that is separate from any of the database systems, or the repository may be part of one of the database systems.
    Type: Application
    Filed: July 13, 2007
    Publication date: April 24, 2008
    Inventors: Meghna Mehta, Yuhuan (Bill) Han, Jinyu Wang, K. Karun, Anguel Novoselsky, Tim Yu, Kongyi Zhou
  • Publication number: 20080098186
    Abstract: Techniques for implementing a scalable DOM and a pluggable DOM are provided. A scalable DOM implementation manages a DOM tree in memory to free unreferenced nodes, avoid generating nodes unnecessarily, and avoid storing multiple versions of the same data on disk. A pluggable DOM implementation includes an abstract interface that is defined between the API layer and the data layer of a DOM implementation. An implementation of the abstract interface is defined for each data source that is plugged in to the pluggable DOM implementation and that stores XML data in a different format.
    Type: Application
    Filed: July 13, 2007
    Publication date: April 24, 2008
    Inventors: Kongyi Zhou, K. Karun, Jinyu Wang, Tim Yu
  • Publication number: 20050203957
    Abstract: An XML Extractor that extracts XML data from streamed input based on registered XPaths. XPaths and associated content handlers instances are registered at runtime with the XML Extractor. The XML receives streaming input that represents XML data at a stream-based parser, and evaluates the received input against the registered XPaths expression. In response to detecting that the received streaming input includes an XPath that matches a registered XPath expression, generating output to the content handler associated with the matching registered XPath expression.
    Type: Application
    Filed: March 14, 2005
    Publication date: September 15, 2005
    Applicant: ORACLE INTERNATIONAL CORPORATION
    Inventors: Jinyu Wang, Mark Scardina, Kongyi Zhou
  • Patent number: D1001279
    Type: Grant
    Filed: June 7, 2022
    Date of Patent: October 10, 2023
    Inventors: Tingjia Chen, Jinyu Wang, Jing Lyu