Abstract: Polypeptides having a length of up to 180 amino acids and containing a sequence selected from sequences identical or differing at most in 5 amino acids from the sequence: KSELAVEILEKGQVRFWMQA GNAKVNYIFNEKEIFEG PKYKMHID GIIEMFMEKLQDEDEGTYTFQLQ NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQG.

Abstract: The present invention provides polypeptides having a length of up to 180 amino acids and containing a sequence selected from sequences identical or differing at most in 5 amino acids from the sequence: KSELAVEILEKGQVRFWMQAX21X22X23X24GNAKVNYIFNEKEIFEGPKYKMHIDXsoXsiXszGIIEM FMEKLQDEDEGTYTFQLQX76X77X78X79X80NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQG (SEQ ID NO. 2), wherein X21X22X23X24 is selected from KAQQ (SEQ ID NO. 33), LSVF (SEQ ID NO. 34), ATPS (SEQ ID NO. 35), EIMW (SEQ ID NO. 36), DGSS (SEQ ID NO. 37), LLPL (SEQ ID NO. 38), WMWW (SEQ ID NO. 39), MNLY (SEQ ID NO. 40), MWRN (SEQ ID NO. 41), IMME (SEQ ID NO. 42), KHQL (SEQ ID NO. 43), HWQF (SEQ ID NO. 44), YAGN (SEQ ID NO. 45) and HGQW (SEQ ID NO. 46); X50X51X52 is selected from RNT, IMF, GHE, PSW, RAN, YFW, ITL, QAM, DMR, WLW, QGE, VQY and VSL; X76X77X78X79X80 is selected from SHHLG (SEQ ID NO. 47), FMLMM (SEQ ID NO. 48), VILIL (SEQ ID NO. 49), IVTPL (SEQ ID NO. 50), DFIIW (SEQ ID NO. 51), MWSE (deletion) (SEQ ID NO. 52), LYYAW (SEQ ID NO. 53), MMIEY (SEQ ID NO.

Abstract: The present invention provides polypeptides having a length of up to 180 amino acids and containing a sequence selected from sequences identical or differing at most in 5 amino acids from the sequence: KSELAVEILEKGQVRFWMQAX21X22X23X24GNAKVNYIFNEKEIFEGPKYKMHIDXsoXsiXszGIIEM FMEKLQDEDEGTYTFQLQX76X77X78X79X80NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQG (SEQ ID NO. 2), wherein X21X22X23X24 is selected from KAQQ (SEQ ID NO. 33), LSVF (SEQ ID NO. 34), ATPS (SEQ ID NO. 35), EIMW (SEQ ID NO. 36), DGSS (SEQ ID NO. 37), LLPL (SEQ ID NO. 38), WMWW (SEQ ID NO. 39), MNLY (SEQ ID NO. 40), MWRN (SEQ ID NO. 41), IMME (SEQ ID NO. 42), KHQL (SEQ ID NO. 43), HWQF (SEQ ID NO. 44), YAGN (SEQ ID NO. 45) and HGQW (SEQ ID NO. 46); X50X51X52 is selected from RNT, IMF, GHE, PSW, RAN, YFW, ITL, QAM, DMR, WLW, QGE, VQY and VSL; X76X77X78X79X80 is selected from SHHLG (SEQ ID NO. 47), FMLMM (SEQ ID NO. 48), VILIL (SEQ ID NO. 49), IVTPL (SEQ ID NO. 50), DFIIW (SEQ ID NO. 51), MWSE (deletion) (SEQ ID NO. 52), LYYAW (SEQ ID NO. 53), MMIEY (SEQ ID NO.

Abstract: Cutting tool guide structure (1) for the cutting of an adhesive-backed film partially applied to a surface of a vehicle. The cutting tool guide structure (1) is removably attachable to a surface of a vehicle, contains a cutting slit (4) for receiving a cutting tool (6), and is dimensioned such that the cutting tool can be moved back and forth in one direction within the cutting slit (4) to carry out a cutting action. The guide structure (4) further comprises, at opposite ends, engaging areas (2) that are shaped and configured to match opposite surface areas (5) of the vehicle such that the cutting tool guide structure (1) can be placed with its engaging areas on the surface areas of the vehicle to provide an abutting fit. Further provided are methods of applying an adhesive-backed film to the surface of a vehicle and cutting the film to fit the surface, using the cutting tool guide structure.

Abstract: Cutting tool guide structure (1) for the cutting of an adhesive-backed film partially applied to a surface of a vehicle. The cutting tool guide structure (1) is removably attachable to a surface of a vehicle, contains a cutting slit (4) for receiving a cutting tool (6), and is dimensioned such that the cutting tool can be moved back and forth in one direction within the cutting slit (4) to carry out a cutting action. The guide structure (4) further comprises, at opposite ends, engaging areas (2) that are shaped and configured to match opposite surface areas (5) of the vehicle such that the cutting tool guide structure (1) can be placed with its engaging areas on the surface areas of the vehicle to provide an abutting fit. Further provided are methods of applying an adhesive-backed film to the surface of a vehicle and cutting the film to fit the surface, using the cutting tool guide structure.