Abstract: The present invention provides polypeptides having a length of up to 180 amino acids and containing a sequence selected from sequences identical or differing at most in 5 amino acids from the sequence: KSELAVEILEKGQVRFWMQAX21X22X23X24GNAKVNYIFNEKEIFEGPKYKMHIDXsoXsiXszGIIEM FMEKLQDEDEGTYTFQLQX76X77X78X79X80NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQG (SEQ ID NO. 2), wherein X21X22X23X24 is selected from KAQQ (SEQ ID NO. 33), LSVF (SEQ ID NO. 34), ATPS (SEQ ID NO. 35), EIMW (SEQ ID NO. 36), DGSS (SEQ ID NO. 37), LLPL (SEQ ID NO. 38), WMWW (SEQ ID NO. 39), MNLY (SEQ ID NO. 40), MWRN (SEQ ID NO. 41), IMME (SEQ ID NO. 42), KHQL (SEQ ID NO. 43), HWQF (SEQ ID NO. 44), YAGN (SEQ ID NO. 45) and HGQW (SEQ ID NO. 46); X50X51X52 is selected from RNT, IMF, GHE, PSW, RAN, YFW, ITL, QAM, DMR, WLW, QGE, VQY and VSL; X76X77X78X79X80 is selected from SHHLG (SEQ ID NO. 47), FMLMM (SEQ ID NO. 48), VILIL (SEQ ID NO. 49), IVTPL (SEQ ID NO. 50), DFIIW (SEQ ID NO. 51), MWSE (deletion) (SEQ ID NO. 52), LYYAW (SEQ ID NO. 53), MMIEY (SEQ ID NO.

Abstract: A modular work cell for a production robot includes a base module, on which at least one production robot is arranged, disposed inside the modular work cell. The modular work cell further includes wall elements, a control cabinet, an access, and a feed unit for workpieces which is arranged between the access and the production robot. The base module, the control cabinet, the feed unit and the access form a mechanically and electrically interconnected transport assembly configured for transport. The wall elements can be transported separate from the transport assembly.

Abstract: A modular work cell for a production robot includes a base module, on which at least one production robot is arranged, disposed inside the modular work cell. The modular work cell further includes wall elements, a control cabinet, an access, and a feed unit for workpieces which is arranged between the access and the production robot. The base module, the control cabinet, the feed unit and the access form a mechanically and electrically interconnected transport assembly configured for transport. The wall elements can be transported separate from the transport assembly.