Patents by Inventor John C. Holt

John C. Holt has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Trigramin - a platelet aggregation inhibiting polypeptide
    Patent number: 5066592
    Abstract: Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. The molecule is a potent inhibitor of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets. Trigramin is thus a potent inhibitor of fibrinogen-induced human platelet aggregation. It is useful in inhibiting the formation of hemostatic platelet plugs.
    Type: Grant
    Filed: September 19, 1990
    Date of Patent: November 19, 1991
    Assignee: Temple University of the Commonwealth System of Higher Education
    Inventors: Tur-Fu Huang, Stefan Niewiarowski, John C. Holt, Hanna Lukasiewicz