Patents by Inventor John Shine
John Shine has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).
-
Patent number: 5756460Abstract: The present invention provides a peptide having the amino acid sequence of human galanin. The amino acid sequence of this peptide is: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS (SEQ ID NO: 1). The present invention further provides DNA clones encoding the peptide and to therapeutic uses of the peptide.Type: GrantFiled: July 25, 1995Date of Patent: May 26, 1998Assignee: Garvan Institute of Medical ResearchInventors: Helen Frances Evans, John Shine
-
Patent number: 5571695Abstract: The invention provides cDNA sequence and a genomic DNA sequence which encodes the human neuropeptide Y-Y1 receptor. These DNA sequences can be used to express the NPY-Y1 receptor in cells and can be sued to screen compounds for neuropeptide Y agonist and antagonist activity.Type: GrantFiled: May 26, 1994Date of Patent: November 5, 1996Assignee: Garvan Institute of Medical ResearchInventors: Lisa Selbie, Herbert Herzog, John Shine
-
Patent number: 5320953Abstract: Genes and DNA transfer vector for the expression of human prepororelaxin; subunits thereof, including genes and transfer vectors for expression of human profelaxin and the individual A, B and C peptide chains thereof; and equivalents of al such genes. Methods for synthesis of the peptides involving recombinant DNA techniques.Type: GrantFiled: July 29, 1992Date of Patent: June 14, 1994Assignee: Howard Florey Institute of Experimental Physiology and MedicineInventors: Peter J. Hudson, John Shine, Hugh D. Niall, Geoffrey W. Tregear
-
Patent number: 5145962Abstract: Genes and DNA transfer vector for the expression of human preprorelaxin; subunits thereof, including genes and transfer vectors for expression of human prorelaxin and the individual A, B and C peptide chains thereof; and equivalents of all such genes. Methods for synthesis of the peptides involving recombinant DNA techniques.Type: GrantFiled: April 8, 1991Date of Patent: September 8, 1992Assignee: Howard Florey Institute of Experimental Physiology and MedicineInventors: Peter J. Hudson, John Shine, Hugh D. Niall, Geoffrey W. Tregear
-
Patent number: 5137816Abstract: This invention provides useful promoters from the R. trifolii nifH gene for the construction of recombinant molecules to regulate foreign genes for expression under desired conditions. In particular, the promoters act to control expression of the foreign genes within root nodules formed by rhizobial bacterial strains in symbiotic combination with host plants.A rhizobium diagnostic segment (RDS) is also provided comprising a DNA segment found at more than one location in rhizobia, the RDS being species-specific, and detectable by DNA hybridization under stringent conditions. A recombinant plasmid comprising a RDS and a bacterial strain containing the plasmid are provided. Methods are provided for identifying species and strains of field isolates of Rhizobium, using RDS's. One RDS exemplified comprises 5' sequences from the R. trifolii nifH gene.Type: GrantFiled: May 10, 1991Date of Patent: August 11, 1992Assignee: The Lubrizol CorporationInventors: Barry G. Rolfe, John Shine, Kieran F. Scott, John M. Watson, Peter Schofield
-
Patent number: 5053488Abstract: Genes and DNA transfer vectors for the expression of human preprorelaxin; sub-units thereof, including genes and transfer vectors for expression of human prorelaxin and the individual A, B and C peptide chains thereof; and equivalents of all such genes. Method for synthesis of the peptides involving recombinant DNA techniques are provided.Type: GrantFiled: July 6, 1990Date of Patent: October 1, 1991Assignee: Howard Florey Institute of Experimental Physiology & MedicineInventors: Peter J. Hudson, John Shine, Hugh D. Niall, Geoffrey W. Tregear
-
Patent number: 5008194Abstract: The nifH promoter regions of Bradyrhizobium japonicum and Bradyrhizobium sp. (parasponia) have been sequenced and found to be significantly homologous. Recombinant DNA molecules comprising foreign genes under the control of such promoters are provided. Rhizobial species containing such recombinant constructions, either in plasmids or integrated into the genome, are provided. These are especially useful for expressing desired foreign genes within root nodules.Type: GrantFiled: October 16, 1987Date of Patent: April 16, 1991Assignee: Lubrizol Genetics, Inc.Inventors: Barry G. Rolfe, John Shine, Kieran F. Scott, Hauke Hennecke
-
Patent number: 5001061Abstract: The nifD promoter regions of Bradyrhizobium japonicum and Bradyhizobium sp. (Parasponia) have been sequenced and found to be significantly homologous. Recombinant DNA molecules comprising foreign genes under the control of such promoters are provided. Rhizobial species containing such recombinant constructions, either in plasmids or integrated into the genome, are provided. These are especially useful for expressing desired foreign genes within root nodules.Type: GrantFiled: October 16, 1987Date of Patent: March 19, 1991Assignee: Lubrizol Genetics, Inc.Inventors: Barry G. Rolfe, John Shine, Kieran F. Scott, Hauke Hennecke, Kieran F. Scott
-
Patent number: 4871670Abstract: Genes and DNA transfer vectors for the expression of human preprorelaxin; sub-units thereof, including genes and transfer vectors for expression of human prorelaxin and the individual A, B and C peptide chains thereof; and equivalents of all such genes. Methods for synthesis of the peptides involving recombinant DNA techniques.Type: GrantFiled: May 12, 1986Date of Patent: October 3, 1989Assignee: Howard Florey Institute of Experimental Physiology and MedicineInventors: Peter J. Hudson, John Shine, Hugh D. Niall, Geoffrey W. Tregear
-
Patent number: 4652525Abstract: A recombinant procaryotic microorganism containing the gene coding for insulin.Type: GrantFiled: June 28, 1983Date of Patent: March 24, 1987Assignee: The Regents of the University of CaliforniaInventors: William J. Rutter, Raymond Pictet, John Chirgwin, Howard M. Goodman, Axel Ullrich, John Shine
-
Patent number: 4469631Abstract: DNA comprising the naturally occurring nucleotide sequence coding for amino acids 44-90 of .beta.-lipotropin and including the entire coding region for .beta.-endorphin with the exception of the C-terminal glutamine was modified, transferred to an expression transfer vector, and expressed as a fusion protein. The fusion protein was further modified in vitro to yield mature .beta.-endorphin. .beta.-endorphin was purified from a bacterial lysate. The structure and biological activity of the resulting product was proven by immunological assay, and by two independent assays designed to demonstrate biological activity.Type: GrantFiled: June 10, 1982Date of Patent: September 4, 1984Assignee: The Regents of the University of CaliforniaInventors: John D. Baxter, Ivy Fettes, John Shine
-
Patent number: 4447538Abstract: A microorganism containing a recombinant DNA transfer vector having the coding sequences for human chorionic somatomammotropin.Type: GrantFiled: February 5, 1982Date of Patent: May 8, 1984Assignee: Regents of the University of CaliforniaInventors: Howard M. Goodman, John Shine, Peter H. Seeburg
-
Patent number: 4440859Abstract: Microorganism having a gene derived from a higher organism is produced by isolating cells from a higher organism containing messenger RNA, extracting the messenger RNA, synthesizing a double stranded cDNA using the messenger RNA as a template, inserting the cDNA into a plasmid and transforming a microorganism with the resultant recombinant plasmid.Type: GrantFiled: September 11, 1981Date of Patent: April 3, 1984Assignee: The Regents of the University of CaliforniaInventors: William J. Rutter, Howard M. Goodman, Axel Ullrich, John Shine, John Chirgwin, Raymond Pictet
-
Patent number: 4407948Abstract: A method for purifying a DNA fragment of specific desired nucleotide sequence containing a restriction site, from a population of DNA molecules homogeneous in length by endonuclease cleavage and fractionation.Type: GrantFiled: February 5, 1982Date of Patent: October 4, 1983Assignee: The Regents of the University of CaliforniaInventors: Howard M. Goodman, John Shine, Peter H. Seeburg
-
Patent number: 4363877Abstract: Recombinant DNA transfer vectors containing codons for human somatomammotropin and for human growth hormone.Type: GrantFiled: April 19, 1978Date of Patent: December 14, 1982Assignee: The Regents of the University of CaliforniaInventors: Howard M. Goodman, John Shine, Peter H. Seeburg
-
Patent number: 4350764Abstract: DNA comprising the naturally occurring nucleotide sequence coding for amino acids 44-90 of .beta.-lipotropin and including the entire coding region for .beta.-endorphin with the exception of the C-terminal glutamine was modified, transferred to an expression transfer vector, and expressed as a fusion protein. The fusion protein was further modified in vitro to yield mature .beta.-endorphin. .beta.-endorphin was purified from a bacterial lysate. The structure and biological activity of the resulting product was proven by immunological assay, and by two independent assays designed to demonstrate biological activity.Type: GrantFiled: March 10, 1980Date of Patent: September 21, 1982Assignee: The Regents of the University of CaliforniaInventors: John D. Baxter, Ivy Fettes, John Shine
-
Patent number: 4322499Abstract: A technique suitable for cloning a cDNA having a base sequence coding for the ACTH/LPH precursor is disclosed. The invention is exemplified by the cloning of a cDNA fragment comprising a base sequence coding for the endorphin region. The fragment, hereinafter termed the endorphin gene cDNA sequence, was obtained from cultured mouse pituitary tumor cells known to produce the ACTH/LPH precursor protein.Type: GrantFiled: December 22, 1978Date of Patent: March 30, 1982Assignee: The Regents of the University of CaliforniaInventors: John D. Baxter, James L. Roberts, Peter H. Seeburg, Howard M. Goodman, John Shine
-
Patent number: 4283489Abstract: A method has been discovered for purifying a specific desired DNA sequence, starting from RNA heterogeneous in length and sequence. The steps of the method include making complementary DNA transcripts of the RNA by means of an enzyme such as reverse transcriptase, subjecting the DNA transcripts to the action of one or more selected restriction endonuclease enzymes, and fractionating the fragments produced by endonuclease action according to their length. By this method it is possible to isolate homogeneous length DNA fragments complementary to RNA sequences present in the original preparation in as low a frequency as two percent. A method is also disclosed for further purifying the homogeneous length fragments and for determining their final purity. Using the disclosed methods, a DNA fragment approximately 550 nucleotides in length coding for a portion of the peptide hormone, human chorionic somatomammotropin, has been purified to greater than 99% purity.Type: GrantFiled: November 23, 1979Date of Patent: August 11, 1981Assignee: The Regents of the University of CaliforniaInventors: Howard M. Goodman, John Shine, Peter Horst
-
Patent number: 4264731Abstract: A selected portion of DNA molecules having reactant ends which are capable of being joined in a ligase catalyzed reaction are pretreated so a to remove the 5'-terminal phosphate groups. Such a treatment reduces the frequency of joining an undersired combination and enhances the frequency of joining the desired combination.Type: GrantFiled: April 21, 1978Date of Patent: April 28, 1981Assignee: The Regents of the University of CaliforniaInventor: John Shine