Patents by Inventor Judit Tulla-Puche

Judit Tulla-Puche has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Diketopiperazine Forming Dipeptidyl Linker
    Publication number: 20140343227
    Abstract: The invention relates to a method for homogeneous solution phase peptide synthesis (HSPPS) of a N-terminal peptide fragment PEP-N and a C-terminal peptide fragment C-PEP, with C-PEP carrying a specific diketopiperazine (DKP) comprising C-terminal protecting group, which contains a handle group HG, with HG being connected to the C-terminus of the peptide fragmcnt; thereby this specific DKP comprising C-terminal protecting group can be selectively cleaved from the peptide as a conventionally used C-terminal protecting group. By the use of this DKP and HG comprising C-terminal protecting group, certain process steps in convergent peptide synthesis based on a combination of HSPPS and solid phase peptide synthesis (SPPS) can be avoided.
    Type: Application
    Filed: June 20, 2014
    Publication date: November 20, 2014
    Inventors: Fernando Albericio, Michèle Cristau, Matthieu Giraud, Miriam Gongora Benitez, Judit Tulla-Puche
  • Diketopiperazine forming dipeptidyl linker
    Patent number: 8802819
    Abstract: The invention relates to a method for homogeneous solution phase peptide synthesis (HSPPS) of a N-terminal peptide fragment PEP-N and a C-terminal peptide fragment C-PEP, with C-PEP carrying a specific diketopiperazine (DKP) comprising C-terminal protecting group, which contains a handle group HG, with HG being connected to the C-terminus of the peptide fragment; thereby this specific DKP comprising C-terminal protecting group can be selectively cleaved from the peptide as a conventionally used C-terminal protecting group. By the use of this DKP and HG comprising C-terminal protecting group, certain process steps in convergent peptide synthesis based on a combination of HSPPS and solid phase peptide synthesis (SPPS) can be avoided.
    Type: Grant
    Filed: October 20, 2011
    Date of Patent: August 12, 2014
    Assignee: Lonza Ltd.
    Inventors: Fernando Albericio, Michèle Cristau, Matthieu Giraud, Miriam Gongora Benitez, Judit Tulla-Puche
  • Antitumoral compounds
    Patent number: 8748388
    Abstract: Antitumoral compounds of Formula I, and pharmaceutically acceptable salts, derivatives, tautomers, prodrugs or stereoisomers thereof useful as antitumour agents.
    Type: Grant
    Filed: December 10, 2008
    Date of Patent: June 10, 2014
    Assignee: Pharma Mar, S.A.
    Inventors: Judit Tulla-Puche, Eleonora Marcucci, Núria Bayó-Puxan, Fernando Albericio, Maria del Carmen Cuevas Marchante
  • Diketopiperazine Forming Dipeptidyl Linker
    Publication number: 20140094567
    Abstract: The invention relates to a method for homogeneous solution phase peptide synthesis (HSPPS) of a N-terminal peptide fragment PEP-N and a C-terminal peptide fragment C-PEP, with C-PEP carrying a specific diketopiperazine (DKP) comprising C-terminal protecting group, which contains a handle group HG, with HG being connected to the C-terminus of the peptide fragment; thereby this specific DKP comprising C-terminal protecting group can be selectively cleaved from the peptide as a conventionally used C-terminal protecting group. By the use of this DKP and HG comprising C-terminal protecting group, certain process steps in convergent peptide synthesis based on a combination of HSPPS and solid phase peptide synthesis (SPPS) can be avoided.
    Type: Application
    Filed: October 20, 2011
    Publication date: April 3, 2014
    Applicant: LONZA LTD
    Inventors: Fernando Albericio, Michèle Cristau, Matthieu Giraud, Miriam Gongora Benitez, Judit Tulla-Puche
  • ANTITUMORAL COMPOUNDS
    Publication number: 20110207674
    Abstract: Antitumoral compounds of Formula I, and pharmaceutically acceptable salts, derivatives, tautomers, prodrugs or stereoisomers thereof useful as antitumour agents.
    Type: Application
    Filed: December 10, 2008
    Publication date: August 25, 2011
    Applicant: PHARMA MAR, S.A.
    Inventors: Judit TULLA-PUCHE, Eleonora MARCUCCI, Núria BAYÓ-PUXAN, Fernando ALBERICIO, María del Carmen CUEVAS MARCHANTE
  • Antitumoral Compounds
    Publication number: 20100292163
    Abstract: Antitumoral compounds of Formula I, and pharmaceutically acceptable salts, derivatives, tautomers, prodrugs or stereoisomers thereof useful as antitumour agents.
    Type: Application
    Filed: December 10, 2008
    Publication date: November 18, 2010
    Applicant: Pharma Mar, S.A.
    Inventors: Judit Tulla-Puche, Eleonora Marcucci, Núria Bayo-Puxan, Fernando Albericio, Maria Del Carmen Cuevas Marchante
  • PROCESS FOR THE PRODUCTION OF PRAMLINTIDE
    Publication number: 20100249370
    Abstract: Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively.
    Type: Application
    Filed: June 30, 2008
    Publication date: September 30, 2010
    Applicant: LONZA AG
    Inventors: Andreas Brunner, Oleg Werbitzky, Stephane Varray, Francesca Quattrini, Holger Hermann, Andrew Strong, Fernando Albericio, Judit Tulla-Puche, Yesica Garcia Ramos
  • Mammalian Expression Vector Comprising the MCMV Promoter and First Intron of HCMV Major Immediate Early Gene
    Publication number: 20090181424
    Abstract: A mammalian expression vector that is a murine CMV promoter and the first intron of the major immediate early gene of the human cytomegalovirus. There are mammalian host cells containing the expression vector. There is also a process for the production of recombinant protein by using the expression vector.
    Type: Application
    Filed: April 20, 2006
    Publication date: July 16, 2009
    Inventors: Fernando Albericio, Luis Javier Cruz, Fayna Garcia-Martin, Judit Tulla-Puche
  • Method of peptide synthesis
    Publication number: 20090171068
    Abstract: A method for solid phase synthesis of Thymosin ?1 is devised.
    Type: Application
    Filed: May 4, 2006
    Publication date: July 2, 2009
    Inventors: Fernando Albericio, Luis Javier Cruz, Yesica Garcia Ramos, Judit Tulla-Puche