Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami

Abstract: Provided herein are anti-LTBR multispecific binding molecules, nucleic acids encoding the anti-LTBR multispecific binding molecules, vectors comprising the nucleic acids, host cells comprising the vectors, and pharmaceutical compositions comprising the anti-LTBR multispecific binding molecules. Also provided are methods of treating cancer in a subject in need thereof, the methods comprising administering the pharmaceutical compositions disclosed herein.

Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami

Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami

Abstract: The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6)D(X7)SFHKGEKFQIL(X8)(X9)(X10)(X11)(X12)G(X13)(X14)W(X15)(X16)RSLTTG(X17)(X18)G(X19)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X1) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X2) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X3) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X4) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X5) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X6) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X7) is A, V, I, L, M, G, P, R, H or K; (X8) is S, T, N, Q, C, D or E; (X9) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X10) is A, V, I, L, M, G or P; (X11) is F, Y, W, R, H or K; (X12) is S, T, N, Q, C, F, Y or W; (X13) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X14) is

Abstract: The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6)D(X7)SFHKGEKFQIL(X8)(X9)(X10)(X11)(X12)G(X13)(X14)W(X15)(X16)RSLTTG(X17)(X18)G(X19)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X1) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X2) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X3) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X4) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X5) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X6) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X7) is A, V, I, L, M, G, P, R, H or K; (X8) is S, T, N, Q, C, D or E; (X9) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X10) is A, V, I, L, M, G or P; (X11) is F, Y, W, R, H or K; (X12) is S, T, N, Q, C, F, Y or W; (X13) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X14) is

Abstract: Advantageous bispecific binding molecules that comprise a CD3 binding and a CD33 binding part are provided. The CD3 binding part comprises an antibody that has variations in the Fc region with reduced binding to C1q and Fc gamma receptors. The bispecific binding molecules can be used in the treatment of cancer.

Abstract: Antibody and other Fc-containing molecules with variations in the Fc region with reduced binding to C1q and Fc gamma receptors are provided, which can be used in the treatment of various diseases and disorders.

Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami

Abstract: The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5) (X6)D(X7)SFHKGEKFQIL(X8)(X9)(X10)(X11)(X12)G(X13)(X14)W(X15)(X16)RSLTTG(X17)(X18)G(X19)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X1) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X2) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X3) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X4) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X5) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X6) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X7) is A, V, I, L, M, G, P, R, H or K; (X8) is S, T, N, Q, C, D or E; (X9) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X10) is A, V, I, L, M, G or P; (X11) is F, Y, W, R, H or K; (X12) is S, T, N, Q, C, F, Y or W; (X13) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X14) is

Abstract: The present invention relates to a binding molecule that specifically binds to two different epitopes of an antigen expressed on tumor cells, wherein the binding molecule comprises: (a) a first binding (poly)peptide that specifically binds to a first epitope of said antigen expressed on tumor cells, wherein said first binding (poly)peptide is a Fyn SH3-derived polypeptide; and (b) a second binding (poly)peptide that specifically binds to a second epitope of said antigen expressed on tumor cells. The present invention further relates to a nucleic acid molecule encoding the binding molecule of the invention, a vector comprising said nucleic acid molecule as well as a host cell or a non-human host transformed with said vector. The invention further relates to a method of producing a binding molecule of the invention as well as to pharmaceutical and diagnostic composition.

Abstract: The present invention relates to a binding molecule that specifically binds to two different epitopes of an antigen expressed on tumor cells, wherein the binding molecule comprises: (a) a first binding (poly)peptide that specifically binds to a first epitope of said antigen expressed on tumor cells, wherein said first binding (poly)peptide is a Fyn SH3-derived polypeptide; and (b) a second binding (poly)peptide that specifically binds to a second epitope of said antigen expressed on tumor cells. The present invention further relates to a nucleic acid molecule encoding the binding molecule of the invention, a vector comprising said nucleic acid molecule as well as a host cell or a non-human host transformed with said vector. The invention further relates to a method of producing a binding molecule of the invention as well as to pharmaceutical and diagnostic composition.

Abstract: The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.

Abstract: The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.

Abstract: The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.

Abstract: The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5) (X6)D(X7)SFHKGEKFQIL(X8)(X9)(X10)(X11)(X12)G(X13)(X14)W(X15)(X16)RSLTTG(X17)(X18)G(X19)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X1) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X2) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X3) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X4) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X5) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X6) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X7) is A, V, I, L, M, G, P, R, H or K; (X8) is S, T, N, Q, C, D or E; (X9) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X10) is A, V, I, L, M, G or P; (X11) is F, Y, W, R, H or K; (X12) is S, T, N, Q, C, F, Y or W; (X13) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X14) is

Abstract: The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.

Abstract: The present invention relates to a polypeptide binding to a chymase (EC 3.4.21.

Abstract: The present invention relates to a binding molecule that specifically binds to two different epitopes of an antigen expressed on tumor cells, wherein the binding molecule comprises: (a) a first binding (poly)peptide that specifically binds to a first epitope of said antigen expressed on tumor cells, wherein said first binding (poly)peptide is a Fyn SH3-derived polypeptide; and (b) a second binding (poly)peptide that specifically binds to a second epitope of said antigen expressed on tumor cells. The present invention further relates to a nucleic acid molecule encoding the binding molecule of the invention, a vector comprising said nucleic acid molecule as well as a host cell or a non-human host transformed with said vector. The invention further relates to a method of producing a binding molecule of the invention as well as to pharmaceutical and diagnostic composition.

Abstract: The present invention relates to a polypeptide binding to a chymase (EC 3, 4, 21,39), wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)A(X2)(X3)(X4)(X5) (X6)LSFHKGEKFQIL(X7 (X8)(X9)(X10) (X11)(X12)G(X13)(X14)WEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X1) is R, N, Q, E, K, H, S, T, C, or D; (X2) is E, T, D, Q, L, P, A, S, C, M, N, E, G, A, V or I; (X3) is R, T, H, N, K, S, C, N or Q; (X4) is S, W, T, C, N, Q, For Y; (X5) is T, H, L, F, C, S, M, N, Q, R, K, G, A, V, I, P, Y or W; (X6) is D, Q, H, E, S, T, C, N, R or K; (X7) is D, N, R, E, Q, S, T, C, K or D; (X8) is M, W, G, F, A, S, T, C, S, N, Q, Y, V, L, I or P; (X9) is T, H, S, D, C, N, Q, R, K, E or absent; (X10) is V, T, Q, G, A, L, I, P, S, C, M, N or absent; (X11) is P, A, D, G, K, V, L, I, E, R, M, H or absent; (X12) is N, V, P, I, E, T, S, A, G, L, C, M, Q or D; (X13) is D, E, T, P, G, A, V, L, I, S, C, M, N or Q, and (X14) is W, Y, L, G, A, V, I, P, M, or F; (b)