Abstract: Described are examples for recommending increase in worker instance count for an availability zone in a cloud-based computing platform. A machine learning (ML) model can be used to predict a time series forecast of a workload for the availability zone in a future time period. A predicted number of worker instances to handle the predicted workload can be computed, and if the number of worker instances in the availability zone is less than the predicted number of worker instances, a recommendation to increase the number of worker instances in the availability zone can be generated.

Abstract: A polypeptide or peptidomimetic comprising a sequence of at least 7 residues differing by residue substitutions, deletions or insertions numbering 0-2 compared to the sequence: GLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPT-MSWNDINCEHLNNWICQ (SEQ ID NO: 1), for use as a medicament, in particular in pneumococcal disease.

Abstract: Methods for calculating nutrient content information. In one embodiment, the methods comprise: receiving a recipe having a list of ingredients and quantities, for each of the ingredients a corresponding record is found within a database of known records, the records are associated to quantities and nutritional values. The units of measurement of the recipe ingredients and the identified record are compared. When the units are the same, no conversion is performed. When the units are different, the units of the known record are converted using a conversion factor derived from a relationship between the differing units of measurement. In one variant, the conversion factor may be identified from a table of conversion factors relating various units of measurement to one another. Finally, the converted or the known nutritional values are multiplied by a ratio of the quantity of the ingredient in the recipe to the quantity of the known record.

Abstract: An apparatus includes a solution including a metallic compound, a surfactant, and an acid. The solution is substantially colorless. A container holds the solution.

Abstract: Methods for calculating nutrient content information. In one embodiment, the methods comprise: receiving a recipe having a list of ingredients and quantities, for each of the ingredients a corresponding record is found within a database of known records, the records are associated to quantities and nutritional values. The units of measurement of the recipe ingredients and the identified record are compared. When the units are the same, no conversion is performed. When the units are different, the units of the known record are converted using a conversion factor derived from a relationship between the differing units of measurement. In one variant, the conversion factor may be identified from a table of conversion factors relating various units of measurement to one another. Finally, the converted or the known nutritional values are multiplied by a ratio of the quantity of the ingredient in the recipe to the quantity of the known record.

Abstract: Methods for calculating nutrient content information. In one embodiment, the methods comprise: receiving a recipe having a list of ingredients and quantities, for each of the ingredients a corresponding record is found within a database of known records, the records are associated to quantities and nutritional values. The units of measurement of the recipe ingredients and the identified record are compared. When the units are the same, no conversion is performed. When the units are different, the units of the known record are converted using a conversion factor derived from a relationship between the differing units of measurement. In one variant, the conversion factor may be identified from a table of conversion factors relating various units of measurement to one another. Finally, the converted or the known nutritional values are multiplied by a ratio of the quantity of the ingredient in the recipe to the quantity of the known record.

Abstract: This disclosure describes a transportation matching system that utilizes one or more balancer models to generate an electronic communication distribution strategy based on relative impacts of provider-specific and requester-specific levers over a target time horizon. The disclosed systems utilize the balancer models to generate predictive functions for providers and requesters to determine lever content to distribute (e.g., within electronic communications) to providers and/or requesters to efficiently and/or effectively produce acquisition and/or engagement for a target time horizon. Based on the predictive functions, the disclosed systems generate an electronic communication distribution strategy to provide (or cause to be provided) electronic communications to providers and requesters to efficiently and effectively increase or decrease acquisition and/or engagement.

Abstract: Methods for calculating nutrient content information. In one embodiment, the methods comprise: receiving a recipe having a list of ingredients and quantities, for each of the ingredients a corresponding record is found within a database of known records, the records are associated to quantities and nutritional values. The units of measurement of the recipe ingredients and the identified record are compared. When the units are the same, no conversion is performed. When the units are different, the units of the known record are converted using a conversion factor derived from a relationship between the differing units of measurement. In one variant, the conversion factor may be identified from a table of conversion factors relating various units of measurement to one another. Finally, the converted or the known nutritional values are multiplied by a ratio of the quantity of the ingredient in the recipe to the quantity of the known record.

Abstract: A method and system for providing health task notifications to users. In one embodiment, the method comprises establishing a schedule for the delivery of health task notifications or reminders. The schedule may be entered by the user or provided as an editable default schedule based on the user's inputted health goals. Notifications and/or reminders are then provided according to the schedule. The system includes a means by which the user may interact with the messages to provide a response. For example, the user may acknowledge, dismiss, and/or delay the message. Based on the user's interaction, the message display is completed or reiterated at a predetermined delay time. In some instances, the schedule may also be updated based on the user's response.

Abstract: Methods for calculating nutrient content information. In one embodiment, the methods comprise: receiving a recipe having a list of ingredients and quantities, for each of the ingredients a corresponding record is found within a database of known records, the records are associated to quantities and nutritional values. The units of measurement of the recipe ingredients and the identified record are compared. When the units are the same, no conversion is performed. When the units are different, the units of the known record are converted using a conversion factor derived from a relationship between the differing units of measurement. In one variant, the conversion factor may be identified from a table of conversion factors relating various units of measurement to one another. Finally, the converted or the known nutritional values are multiplied by a ratio of the quantity of the ingredient in the recipe to the quantity of the known record.

Abstract: Methods for calculating nutrient content information. In one embodiment, the methods comprise: receiving a recipe having a list of ingredients and quantities, for each of the ingredients a corresponding record is found within a database of known records, the records are associated to quantities and nutritional values. The units of measurement of the recipe ingredients and the identified record are compared. When the units are the same, no conversion is performed. When the units are different, the units of the known record are converted using a conversion factor derived from a relationship between the differing units of measurement. In one variant, the conversion factor may be identified from a table of conversion factors relating various units of measurement to one another. Finally, the converted or the known nutritional values are multiplied by a ratio of the quantity of the ingredient in the recipe to the quantity of the known record.

Abstract: An apparatus includes a hydrogel including a metallic compound, a surfactant, an acid, agarose and water. The hydrogel is substantially colorless. A radiated hydrogel having a color is formed when the hydrogel receives a low dose of ionizing radiation.

Abstract: Methods for calculating nutrient content information. In one embodiment, the methods comprise: receiving a recipe having a list of ingredients and quantities, for each of the ingredients a corresponding record is found within a database of known records, the records are associated to quantities and nutritional values. The units of measurement of the recipe ingredients and the identified record are compared. When the units are the same, no conversion is performed. When the units are different, the units of the known record are converted using a conversion factor derived from a relationship between the differing units of measurement. In one variant, the conversion factor may be identified from a table of conversion factors relating various units of measurement to one another. Finally, the converted or the known nutritional values are multiplied by a ratio of the quantity of the ingredient in the recipe to the quantity of the known record.

Abstract: A method and system for providing health task notifications to users. In one embodiment, the method comprises establishing a schedule for the delivery of health task notifications or reminders. The schedule may be entered by the user or provided as an editable default schedule based on the user's inputted health goals. Notifications and/or reminders are then provided according to the schedule. The system includes a means by which the user may interact with the messages to provide a response. For example, the user may acknowledge, dismiss, and/or delay the message. Based on the user's interaction, the message display is completed or reiterated at a predetermined delay time. In some instances, the schedule may also be updated based on the user's response.

Abstract: Methods for calculating nutrient content information. In one embodiment, the methods comprise: receiving a recipe having a list of ingredients and quantities, for each of the ingredients a corresponding record is found within a database of known records, the records are associated to quantities and nutritional values. The units of measurement of the recipe ingredients and the identified record are compared. When the units are the same, no conversion is performed. When the units are different, the units of the known record are converted using a conversion factor derived from a relationship between the differing units of measurement. In one variant, the conversion factor may be identified from a table of conversion factors relating various units of measurement to one another. Finally, the converted or the known nutritional values are multiplied by a ratio of the quantity of the ingredient in the recipe to the quantity of the known record.

Abstract: Techniques are provided for calculating nutrient content information. A server that hosts a fitness management application receives text information that describes food recipe information. The server parses the text information to identify relevant food information. The relevant food information includes a first text portion that corresponds to food ingredient information and a second text portion that corresponds to food quantity information. The server matches the food ingredient information to the first text portion with a known food ingredient in a database of food ingredient information. The server converts the food quantity information in the second text portion to a known food quantity type. The server calculates nutrient content information of the food ingredient information using nutritional information of the known food ingredient and the known food quantity type.

Abstract: An apparatus includes a solution including a metallic compound, a surfactant, and an acid. The solution is substantially colorless. A container holds the solution. A radiated solution is formed when the solution receives a low dose of ionizing radiation.

Abstract: Techniques are provided for calculating nutrient content information. A server that hosts a fitness management application receives text information that describes food recipe information. The serer parses the text information to identify relevant food information. The relevant food information includes a first text portion that corresponds to food ingredient information and a second text portion that corresponds to food quantity information. The server matches the food ingredient information to the first text portion with a known food ingredient in a database of food ingredient information. The server converts the food quantity information in the second text portion to a known food quantity type. The server calculates nutrient content information of the food ingredient information using nutritional information of the known food ingredient and the known food quantity type.