Patents by Inventor Kelly D. Smith

Kelly D. Smith has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Toll-like receptor 5 ligands and methods of use
    Patent number: 9085616
    Abstract: The invention provides methods to elicit an immune response with an immunomodulatory flagellin polypeptide having toll-like receptor 5 (TLR5) binding, and further comprising an ADCC targeting molecule.
    Type: Grant
    Filed: July 26, 2011
    Date of Patent: July 21, 2015
    Assignees: THE UNIVERSITY FOR SYSTEMS BIOLOGY, UNIVERSITY OF WASHINGTON
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • Toll-like receptor 5 ligands and methods of use
    Patent number: 8703146
    Abstract: The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding.
    Type: Grant
    Filed: November 16, 2004
    Date of Patent: April 22, 2014
    Assignee: Institute for Systems Biology
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • TOLL-LIKE RECEPTOR 5 LIGANDS AND METHODS OF USE
    Publication number: 20120269855
    Abstract: The invention provides methods to elicit an immune response with an immunomodulatory flagellin polypeptide having toll-like receptor 5 (TLR5) binding, and further comprising an ADCC targeting molecule.
    Type: Application
    Filed: July 26, 2011
    Publication date: October 25, 2012
    Applicants: University of Washington, The Institute For Systems Biology
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • Toll-like receptor 5 ligands and methods of use
    Patent number: 7915381
    Abstract: The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT (SEQ ID NO:2), or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided.
    Type: Grant
    Filed: April 17, 2002
    Date of Patent: March 29, 2011
    Assignees: Institute for Systems Biology, University of Washington
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • TOLL-LIKE RECEPTOR 5 LIGANDS AND METHODS OF USE
    Publication number: 20110008318
    Abstract: The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT, or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided.
    Type: Application
    Filed: August 24, 2009
    Publication date: January 13, 2011
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • Toll-like receptor 5 ligands and methods of use
    Publication number: 20030044429
    Abstract: The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT, or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided.
    Type: Application
    Filed: April 17, 2002
    Publication date: March 6, 2003
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky