Patents by Inventor Kirill V. OVCHINNIKOV

Kirill V. OVCHINNIKOV has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 11648289
    Abstract: The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.
    Type: Grant
    Filed: October 1, 2020
    Date of Patent: May 16, 2023
    Assignee: NORWEGIAN UNIVERSITY OF LIFE SCIENCES
    Inventors: Dzung B. Diep, Kirill V. Ovchinnikov, Per E. Kristiansen, Ingolf F. Nes, Tage Thorstensen
  • Publication number: 20210024588
    Abstract: The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINVVYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINVVYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.
    Type: Application
    Filed: October 1, 2020
    Publication date: January 28, 2021
    Applicant: NORWEGIAN UNIVERSITY OF LIFE SCIENCES
    Inventors: Dzung B. DIEP, Kirill V. OVCHINNIKOV, Per E. KRISTIANSEN, Ingolf F. NES, Tage THORSTENSEN
  • Publication number: 20210017236
    Abstract: The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis, E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.
    Type: Application
    Filed: October 1, 2020
    Publication date: January 21, 2021
    Applicant: NORWEGIAN UNIVERSITY OF LIFE SCIENCES
    Inventors: Dzung B. DIEP, Kirill V. OVCHINNIKOV, Per E. KRISTIANSEN, Ingolf F. NES, Tage THORSTENSEN
  • Patent number: 10851139
    Abstract: The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis. E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.
    Type: Grant
    Filed: December 14, 2017
    Date of Patent: December 1, 2020
    Assignee: NORWEGIAN UNIVERSITY OF LIFE SCIENCES
    Inventors: Dzung B. Diep, Kirill V. Ovchinnikov, Per E. Kristiansen, Ingolf F. Nes, Tage Thorstensen
  • Publication number: 20190322705
    Abstract: The present invention provides a method of killing, damaging or preventing the replication of bacteria comprising administering or applying a bacteriocin to said bacteria, wherein said bacteriocin is a peptide comprising the amino acid sequence MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC and related sequences, wherein the bacteria is selected from E. faecium, E. faecalis. E. hirae, S. pseudointermedius and/or S. hemolyticus; and/or in said method said bacteria are subjected to a stress condition. Also provided are related methods and uses such as methods of treatment. Also provided are novel truncation and fusion proteins variants such as MIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA and MKFKFNPTGTIVKKLTQYEINWYKQQYGRYPWERPVA and their use as bacteriocins in various methods and uses.
    Type: Application
    Filed: December 14, 2017
    Publication date: October 24, 2019
    Applicant: NORWEGIAN UNIVERSITY OF LIFE SCIENCES
    Inventors: Dzung B. DIEP, Kirill V. OVCHINNIKOV, Per E. KRISTIANSEN, Ingolf F. NES, Tage THORSTENSEN