Abstract: The present disclosure provides an acoustic output apparatus. The acoustic output apparatus includes at least one low-frequency acoustic driver that outputs sounds from at least two first sound guiding holes, at least one high-frequency acoustic driver that outputs sounds from at least two second sound guiding holes, and a support component. The support component may be configured to support the at least one high-frequency acoustic driver and the at least one low-frequency acoustic driver, and cause the at least two first sound guiding holes and the at least two second sound guiding holes to locate away from a position of an ear of a user.

Abstract: The present invention provides, in part, compounds of Formula I: or an N-oxide thereof, or a pharmaceutically acceptable salt of the compound or the N-oxide, wherein: X1, X2, R1, R2, m and n are as described herein; processes for the preparation of; intermediates used in the preparation of; and compositions containing such compounds, N-oxides, or salts, and their uses for treating M4-mediated (or M4-associated) disorders including, e.g., Alzheimer's Disease, Parkinson's Disease, schizophrenia (e.g., its cognitive and negative symptoms), pain, addiction, and a sleep disorder.

Abstract: The present disclosure provides a method of smart gas pipeline cleaning management for safety management and an Internet of Things system. The method comprises: obtaining operation feature of at least one gas pipeline and inspection data of the at least one gas pipeline; determining an area to be cleaned and an area feature of the area to be cleaned based on the operation feature of the at least one gas pipeline and the inspection data of the at least one gas pipeline; determining a pipeline cleaning solution based on the area feature of the area to be cleaned; evaluating a pipeline cleaning effect of the pipeline cleaning solution based on an implementation of the pipeline cleaning solution. The Internet of Things system comprises a smart gas user platform, a smart gas service platform, a smart gas sensing network platform, and a smart gas object platform.

Abstract: The present disclosure provides an industrial IoT for correction and regulation of a defective product, a control method, and a storage medium. The industrial IoT includes a user platform, a service platform, a management platform, and a sensing network platform that interact in sequence. The service platform, the management platform, and the sensing network platform are all arranged in a front-sub-platform layout. The control method is applied in the industrial IoT. The industrial IoT may calculate whether a defective product is correctable according to a correction cost of the defective product, and may reduce the correction cost and a time consumption of a corresponding correction device, thereby reducing correction cost of the defective product and a loss in a manufacturing process, further ensuring a normal product manufacturing efficiency of the correction device, and thus reducing a correction loss of a waste product and the defective product.

Abstract: An optical waveguide-type soft photoactuator based on an optical micro/nanofiber includes an optical micro/nanofiber, a first deformed material membrane, and a second deformed material membrane. One end of the optical micro/nanofiber is provided with a taper region and a waist region, and the taper region and the waist region are encapsulated in the first deformed material membrane. The second deformed material membrane covers a side of the first deformed material membrane, and the first deformed material membrane or the second deformed material membrane is doped with a photothermal conversion material. The refractive index of the first deformed material membrane is less than the refractive index of a core of the optical micro/nanofiber. The coefficient of thermal expansion of the first deformed material membrane and a coefficient of thermal expansion of the second deformed material membrane are different.

Abstract: A wireless communication method and apparatus. The method includes a terminal obtains a first sequence, and pads or truncates the first sequence to determine a second sequence having a reference signal length; the terminal outputs the second sequence to a network device; the network device receives the second sequence output by the terminal; the network device obtains, based on the second sequence, a third sequence of which a length is a first sequence length 2m; and based on the third sequence, the network device identifies active users and/or performs channel estimation. In the above technical solution, the terminal obtains the second sequence having the reference signal length by padding or truncating the obtained first sequence. The second sequence is output and used for identification of active users and/or channel estimation.

Abstract: The present disclosure provides an Industrial Internet of Things for implementing a production task plan, including at least one user platform, a service platform, a management platform, a sensor network platform, and one or more object platforms that are interacted sequentially from top to bottom; the service platform is arranged in an independent layout, the management platform is arranged in a front sub platform layout, and the sensor network platform is arranged in a rear sub platform layout; the one or more object platforms are configured as one or more intelligent manufacturing devices or one or more manufacturing management devices.

Abstract: The present invention provides, in part, compounds of Formula I: or an N-oxide thereof, or a pharmaceutically acceptable salt of the compound or the N-oxide, wherein: R1, R2, L, A, and E are as described herein; processes for the preparation of; intermediates used in the preparation of; and compositions containing such compounds, N-oxides, or salts, and their uses for treating M4-mediated (or M4-associated) disorders including, e.g., Alzheimer's Disease, schizophrenia (e.g., its cognitive and negative symptoms), pain, addiction, and a sleep disorder.

Abstract: Provided is a nano antibody, the amino acid sequence thereof being EVQLQASGGGFVQPGGSLRLSCAASGFTFSSX1AMGWFRQAPGKEREX2VSAISSGGGNTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCVTPGGRLWYYRYDYRCQGTQVTVSS (SEQ ID NO: 1), where X1 is selected from Y or F, and X2 is selected from F or L. The antibody can be used to dissolve Charcot-Leyden crystals (CLCs), thereby reducing pulmonary inflammation, changes in lung function, and mucus production. Further provided is the use of the nano antibody in the preparation of a drug and a reagent for testing Charcot-Leyden crystals (CLCs) and/or Galectin-10 protein.

Abstract: The present application discloses a sound-output device, a vibration speaker configured to generate a bone-conducted sound wave; and an air-conducted speaker configured to generate an air-conducted sound wave. The vibration speaker is coupled to the air-conducted speaker through a mechanical structure; and the bone-conducted sound wave is input to the air-conducted speaker at least in part as an input signal.

Abstract: The present disclosure is a method for optimizing a working state of a bone conduction earphone. The bone conduction earphone includes an earphone core and at least one vibration sensor. The method includes: obtaining a vibration signal through the at least one vibration sensor, the vibration signal being at least partially derived from vibration generated by the earphone core in response to an audio signal, and the vibration of the earphone core being transmitted to a user wearing the bone conduction earphone through bone conduction; determining a vibration response feature of the earphone core based on the vibration signal and the audio signal; and feeding back a working state of the bone conduction earphone based on the vibration response feature of the earphone core.

Abstract: This application provides a data transmission method and an apparatus. In an example method, a first sequence and a common sequence group are obtained, where a quantity of sequences in the common sequence group is N; the first sequence includes K first sub-sequences, lengths of the K first sub-sequences are sequentially B1, B2, . . . , BK, K is a positive integer, B1=log2N, and the length B1 of a 1st first sub-sequence is greater than or equal to a length of another first sub-sequence. The K first sub-sequences are separately mapped into K second sub-sequences based on the common sequence group. A second sequence including the K second sub-sequences is output.

Abstract: The present disclosure may provide a sound-producing device comprising a diaphragm and a housing. The housing may include a first sound guide hole and a second sound guide hole. The diaphragm may be disposed in the housing. When a user wears the sound-producing device, a distance between the first sound guide hole and the ear canal opening may be smaller than a distance between the diaphragm and the ear canal opening, a range of an included angle between a connection line between the first sound guide hole and the second sound guide hole and a connection line between the center of mass of the diaphragm and the ear canal opening may be smaller than 45°, and a distance between the second sound guide hole and the ear canal opening may be greater than the distance between the diaphragm and the ear canal opening.

Abstract: Embodiments of this application provide a data transmission method and apparatus. A method at a transmit end includes: obtaining a first sequence, where the first sequence includes a first sub-sequence and a second sub-sequence; mapping the first sub-sequence into K third sub-sequences based on a preset sequence group; performing differential coding and phase modulation on the second sub-sequence to obtain a fourth sequence whose length is K?; obtaining K fifth sub-sequences based on the K third sub-sequences and the K? fourth sub-sequences; and outputting a second sequence including the K fifth sub-sequences. A method at a receive end includes: obtaining a second sequence including K fifth sub-sequences, and detecting the K fifth sub-sequences based on a preset sequence group to obtain a first sub-sequence; and performing differential demodulation based on the first sub-sequence to obtain a second sub-sequence, so that a first sequence is determined.

Abstract: The present disclosure provides an acoustic output apparatus including one or more status sensors, at least one low-frequency acoustic driver, at least one high-frequency acoustic driver, at least two first sound guiding holes, and at least two second sound guiding holes. The status sensors may detect status information of a user. The low-frequency acoustic driver may generate at least one first sound, a frequency of which is within a first frequency range. The high-frequency acoustic driver may generate at least one second sound, a frequency of which is within a second frequency range including at least one frequency exceeding the first frequency range. The first and second sound guiding holes may output the first and second spatial sound, respectively. The first and second sound may be generated based on the status information, and may simulate a target sound coming from at least one virtual direction with respect to the user.

Abstract: The present invention relates to a magnetic recording medium including a substrate; an underlayer laminated upon the substrate; and a magnetic layer laminated upon the underlayer, wherein the underlayer includes a first underlayer containing a compound represented by a following general formula: MgO(1-X), where X is within a range of 0.07 to 0.25, the magnetic layer includes a first magnetic layer containing an alloy having a L10 structure, and the alloy having the L10 structure includes B, and the first underlayer is in contact with the first magnetic layer.

Abstract: Methods for configuring and acquiring system information and apparatuses thereof. The method for configuring includes: generating scheduling information based on a correlation between a system information area identity and an area scope; and transmitting the scheduling information.