Patents by Inventor MAHMOUD KANDEEL
MAHMOUD KANDEEL has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).
-
Patent number: 11945819Abstract: Novel dimethyl 7-bromo-1-(4-substituted benzoyl)pyrrolo[1,2-?]quinoline-2,3-dicarboxylates compounds, having the structure: A method of synthesizing said compounds, a pharmaceutical composition comprising said compounds and a suitable carrier, and a method of using the compounds. The dimethyl 7-bromo-1-(4-substituted benzoyl)pyrrolo[1,2-?]quinoline-2,3-dicarboxylates compounds, identified as anti-inflammatory agents, are useful for treating inflammation, pain, and swelling in a patient.Type: GrantFiled: September 21, 2023Date of Patent: April 2, 2024Assignee: KING FAISAL UNIVERSITYInventors: Katharigatta N. Venugopala, Pran Kishore Deb, Pramod Patil, Osama I. Alwassil, Mohamed A. Morsy, Bandar Aldhubiab, Vijaykumar Uppar, Mahmoud Kandeel, Praveen B. Managutti, Basavaraj Padmashali
-
Patent number: 11939294Abstract: Compounds for treating tuberculosis and, particularly, to anti-tubercular compounds that are 1-(2-(substitutedphenyl)-2-oxoethyl)-3,5-dimethylpyridin-1-ium bromides and their use as anti-tubercular agents.Type: GrantFiled: October 23, 2023Date of Patent: March 26, 2024Assignee: KING FAISAL UNIVERSITYInventors: Katharigatta N. Venugopala, Mahmoud Kandeel, Melendran Pillay, Osama I. Alwassil, Mohamed A. Morsy, Rashmi Venugopala, Sandeep Chandrashekharappa, Bandar E. Aldhubiab
-
Patent number: 11939354Abstract: Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.Type: GrantFiled: September 25, 2023Date of Patent: March 26, 2024Assignee: KING FAISAL UNIVERSITYInventor: Mahmoud Kandeel
-
Patent number: 11866461Abstract: Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #121 (SEQ ID NO: 2: HVLGDISGINASVVQIQKEIDRLNEVAKNLHESLIYLQE), and peptide #125 (SEQ ID NO: 3: HRLRQIRGIRARVVQIQKEIWRLNEVAKLLNESLIYLQE). The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.Type: GrantFiled: May 16, 2023Date of Patent: January 9, 2024Assignee: KING FAISAL UNIVERSITYInventor: Mahmoud Kandeel
-
Patent number: 11806358Abstract: Methods of treating trypanosomiasis and, particularly, methods of treating trypanosomiasis using neohesperidin dihydrochalcone. Such methods of treatment are useful in, for example, animals selected from the group consisting of cattle, sheep, pigs, goats, horses, and camels.Type: GrantFiled: April 6, 2023Date of Patent: November 7, 2023Assignee: KING FAISAL UNIVERSITYInventor: Mahmoud Kandeel
-
Patent number: 11801247Abstract: Methods of treating trypanosomiasis and, particularly, to methods of treating trypanosomiasis using raltitrexed. Such methods of treatment are useful in, for example, animals selected from the group consisting of cattle, sheep, pigs, goats, horses, and camels.Type: GrantFiled: April 7, 2023Date of Patent: October 31, 2023Assignee: KING FAISAL UNIVERSITYInventor: Mahmoud Kandeel
-
Patent number: 11801249Abstract: A method of treating a protozoan infection includes administering an antiprotozoal agent to a patient in need thereof. The antiprotozoal agent is selected from Compound 1 (4-{3-[4-(4-fluorophenyl)-1H-pyrazol-5-yl]piperidin-1-yl}-7H-pyrrolo[2,3-d]pyrimidine) and Compound 2 (6-{3-[4-(4-fluorophenyl)-1H-pyrazol-5-yl]piperidin-1-yl}-9H-purine). Compounds 1 and 2 exhibit broad spectrum trypanocidal activity.Type: GrantFiled: April 3, 2023Date of Patent: October 31, 2023Assignee: KING FAISAL UNIVERSITYInventor: Mahmoud Kandeel
-
Patent number: 11786535Abstract: A method of inhibiting cyclooxygenase includes administering an inhibitory agent to a patient in need thereof. The inhibitory agent is selected from Compound 1 (5-{[(4-fluorobenzyl)(tetrahydrofuran-2-ylmethyl)amino]methyl}-2-methoxyphenyl)methanol), Compound 2 (N-{[3-(3-methoxyphenyl)-1-phenyl-1H-pyrazol-4-yl]methyl}-N-methyl-2-(1H-pyrazol-4-yl)ethanamine), Compound 3 ({4-[3-(2-pyridinyl)benzyl]-3-morpholinyl}acetic acid), and Compound 4 ([4-chloro-2-(7-oxo-5,6,7,8-tetrahydro-1H-pyrazole[4,3-g]quinoline-5-yl)phenoxy]acetic acid). Compounds 1-4 may inhibit both the COX-1 and the COX-2 enzymes.Type: GrantFiled: February 22, 2023Date of Patent: October 17, 2023Assignee: KING FAISAL UNIVERSITYInventors: Mahmoud Kandeel, Shady Burayk
-
Patent number: 11707504Abstract: Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #1 (SEQ ID NO: 1: SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL), peptide #4 (SEQ ID NO: 2: SLTQINWTLLDLTYEMESLQQVVKALNESYIDLKEL), and peptide #11 (SEQ ID NO: 11: SLTQINTTLLDLEYEMRSLEEVVKKLNESYIDLKEL. The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.Type: GrantFiled: June 27, 2022Date of Patent: July 25, 2023Assignee: KING FAISAL UNIVERSITYInventors: Mahmoud Kandeel Elsayed, Abdullah I. Al-Mubarak
-
Publication number: 20230172907Abstract: SARS-CoV-2 inhibitors include pharmaceutical compounds capable of binding to the active site of SARS-CoV-2 Mpro. The SARS-CoV-2 inhibitors may be used in pharmaceuticals to prevent and/or treat SARS-CoV-2 infection. The pharmaceuticals may be formulated to comprise at least one SARS-CoV-2 inhibitor and a carrier, or they may include at least one SARS-CoV-2 inhibitor and a further pharmaceutical compound known to be effective against SARS-CoV-2.Type: ApplicationFiled: June 3, 2022Publication date: June 8, 2023Inventors: MAHMOUD KANDEEL, HYUNG-JOO KWON
-
Patent number: 11478464Abstract: A method of treating inflammation includes administering an anti-inflammatory agent to a patient in need thereof. The anti-inflammatory agent is selected from Compound 1 ([(2-{[3-(4-methyl-1H-benzimidazol-2-yl)piperidin-1-yl]carbonyl}phenyl) amino] acetic acid) and Compound 2 (Ethyl-1-(5-cyano-2-hydroxyphenyl)-4-oxo-5-phenoxy-1,4-dihydropyridine-3-carboxylate). Compound 1 and Compound 2 selectively inhibit COX-2 enzyme, without substantially inhibiting COX-1 enzyme, in contrast to many other NSAIDs.Type: GrantFiled: February 6, 2022Date of Patent: October 25, 2022Assignee: KING FAISAL UNIVERSITYInventors: Mahmoud Kandeel Elsayed, Shady Burayk
-
Patent number: 11479582Abstract: Anti-SARS-CoV-2 fusion peptides are provided. The anti-SARS-CoV-2 fusion peptides include peptide sequences corresponding to the sequence of the SARS-CoV-2 fusion complex heptad repeat domain HR2 and having at least one artificial mutation. The anti-SARS-CoV-2 fusion peptides may be 39-mers, such as peptides #121 (SEQ ID NO: 2) and #125 (SEQ ID NO: 5). These peptides may competitively bind to SARS-CoV-2 and prevent either membrane mediated SARS-CoV-2 fusion, endocytosis-mediated viral entry, or both. The anti-SARS-CoV-2 fusion peptides may be administered to a subject in need thereof to inhibit or prevent SARS-CoV-2 cellular entry.Type: GrantFiled: August 24, 2021Date of Patent: October 25, 2022Assignee: KING FAISAL UNIVERSITYInventors: Mahmoud Kandeel Elsayed, Mizuki Yamamoto, Jin Gohda, Jun-Ichiro Inoue, Yasushi Kawaguchi, Hyung-Joo Kwon, Abdulla Al-Taher
-
Patent number: 11446286Abstract: A method of treating fungal infections using dabigatran etexilate is provided. The method can include administering a therapeutically effective amount of dabigatran etexilate to a subject in need thereof. In an embodiment, dabigatran etexilate may be effective as a broad-spectrum antifungal agent and may be used to treat infections resulting from a wide array of fungal pathogens. In an embodiment, dabigatran etexilate may be administered to treat either a topical or systemic fungal infection.Type: GrantFiled: February 28, 2022Date of Patent: September 20, 2022Assignee: KING FAISAL UNIVERSITYInventors: Mahmoud Kandeel Elsayed, Naser Abdullah Alhumam, Abdulla Yousef Al-Taher
-
Publication number: 20220119456Abstract: Anti-SARS-CoV-2 fusion peptides are provided. The anti-SARS-CoV-2 fusion peptides include peptide sequences corresponding to the sequence of the SARS-CoV-2 fusion complex heptad repeat domain HR2 and having at least one artificial mutation. The anti-SARS-CoV-2 fusion peptides may be 39-mers, such as peptides #121 (SEQ ID NO: 2) and #125 (SEQ ID NO: 5). These peptides may competitively bind to SARS-CoV-2 and prevent either membrane mediated SARS-CoV-2 fusion, endocytosis-mediated viral entry, or both. The anti-SARS-CoV-2 fusion peptides may be administered to a subject in need thereof to inhibit or prevent SARS-CoV-2 cellular entry.Type: ApplicationFiled: August 24, 2021Publication date: April 21, 2022Inventors: MAHMOUD KANDEEL ELSAYED, MIZUKI YAMAMOTO, JIN GOHDA, JUN-ICHIRO INOUE, YASUSHI KAWAGUCHI, HYUNG-JOO KWON, ABDULLA AL-TAHER
-
Publication number: 20210332086Abstract: The MERS-CoV inhibitor peptides include a set of peptides designed by modification or mutation of a wild type MERS-CoV fusion protein. The MERS-CoV inhibitor peptides are capable of inhibition of MERS-CoV membrane fusion, and thereby may prevent or slow the spread of MERS-CoV infections. Thus, the MERS-CoV inhibitor peptides may be used in pharmaceuticals to prevent and/or treat MERS-CoV infection. The pharmaceuticals may be formulated to comprise at least one of the MERS-CoV inhibitor peptides and a carrier, or they may include one or more expression systems capable of promoting cellular expression of one or more MERS-CoV inhibitor peptides. The MERS-CoV inhibitor peptides may also be used as reagents for MERS-CoV inhibition assays as a standard or reference inhibitors.Type: ApplicationFiled: March 11, 2021Publication date: October 28, 2021Inventors: MAHMOUD KANDEEL ELSAYED, ABDULLA YOUSEF AL-TAHER, HYUNG-JOO KWON, MOHAMMED AL-NAZAWI
-
Patent number: 10975126Abstract: The MERS-CoV inhibitor peptides include a set of peptides designed by modification or mutation of a wild type MERS-CoV fusion protein. The MERS-CoV inhibitor peptides are capable of inhibition of MERS-CoV membrane fusion, and thereby may prevent or slow the spread of MERS-CoV infections. Thus, the MERS-CoV inhibitor peptides may be used in pharmaceuticals to prevent and/or treat MERS-CoV infection. The pharmaceuticals may be formulated to comprise at least one of the MERS-CoV inhibitor peptides and a carrier, or they may include one or more expression systems capable of promoting cellular expression of one or more MERS-CoV inhibitor peptides. The MERS-CoV inhibitor peptides may also be used as reagents for MERS-CoV inhibition assays as a standard or reference inhibitors.Type: GrantFiled: April 23, 2020Date of Patent: April 13, 2021Assignee: KING FAISAL UNIVERSITYInventors: Mahmoud Kandeel Elsayed, Abdulla Yousef Al-Taher, Hyung-Joo Kwon, Mohammed Al-Nazawi