Abstract: Fusion peptide inhibitors of human coronavirus 229E are provided. The fusion peptide inhibitors of HCoV-229E include peptide #1 (SEQ ID NO: 1: SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL), peptide #4 (SEQ ID NO: 2: SLTQINWTLLDLTYEMESLQQVVKALNESYIDLKEL), and peptide #11 (SEQ ID NO: 11: SLTQINTTLLDLEYEMRSLEEVVKKLNESYIDLKEL. The fusion peptide inhibitors of HCoV-229E may be administered to a subject in need thereof to inhibit or prevent HCoV-229E cellular entry or infection with HCoV-229E. The fusion peptide inhibitors of HCoV-229E may also be used in HCoV-229E inhibition assays.

Abstract: A method of treating inflammation includes administering an anti-inflammatory agent to a patient in need thereof. The anti-inflammatory agent is selected from Compound 1 ([(2-{[3-(4-methyl-1H-benzimidazol-2-yl)piperidin-1-yl]carbonyl}phenyl) amino] acetic acid) and Compound 2 (Ethyl-1-(5-cyano-2-hydroxyphenyl)-4-oxo-5-phenoxy-1,4-dihydropyridine-3-carboxylate). Compound 1 and Compound 2 selectively inhibit COX-2 enzyme, without substantially inhibiting COX-1 enzyme, in contrast to many other NSAIDs.

Abstract: Anti-SARS-CoV-2 fusion peptides are provided. The anti-SARS-CoV-2 fusion peptides include peptide sequences corresponding to the sequence of the SARS-CoV-2 fusion complex heptad repeat domain HR2 and having at least one artificial mutation. The anti-SARS-CoV-2 fusion peptides may be 39-mers, such as peptides #121 (SEQ ID NO: 2) and #125 (SEQ ID NO: 5). These peptides may competitively bind to SARS-CoV-2 and prevent either membrane mediated SARS-CoV-2 fusion, endocytosis-mediated viral entry, or both. The anti-SARS-CoV-2 fusion peptides may be administered to a subject in need thereof to inhibit or prevent SARS-CoV-2 cellular entry.

Abstract: A method of treating fungal infections using dabigatran etexilate is provided. The method can include administering a therapeutically effective amount of dabigatran etexilate to a subject in need thereof. In an embodiment, dabigatran etexilate may be effective as a broad-spectrum antifungal agent and may be used to treat infections resulting from a wide array of fungal pathogens. In an embodiment, dabigatran etexilate may be administered to treat either a topical or systemic fungal infection.

Abstract: Anti-SARS-CoV-2 fusion peptides are provided. The anti-SARS-CoV-2 fusion peptides include peptide sequences corresponding to the sequence of the SARS-CoV-2 fusion complex heptad repeat domain HR2 and having at least one artificial mutation. The anti-SARS-CoV-2 fusion peptides may be 39-mers, such as peptides #121 (SEQ ID NO: 2) and #125 (SEQ ID NO: 5). These peptides may competitively bind to SARS-CoV-2 and prevent either membrane mediated SARS-CoV-2 fusion, endocytosis-mediated viral entry, or both. The anti-SARS-CoV-2 fusion peptides may be administered to a subject in need thereof to inhibit or prevent SARS-CoV-2 cellular entry.

Abstract: The MERS-CoV inhibitor peptides include a set of peptides designed by modification or mutation of a wild type MERS-CoV fusion protein. The MERS-CoV inhibitor peptides are capable of inhibition of MERS-CoV membrane fusion, and thereby may prevent or slow the spread of MERS-CoV infections. Thus, the MERS-CoV inhibitor peptides may be used in pharmaceuticals to prevent and/or treat MERS-CoV infection. The pharmaceuticals may be formulated to comprise at least one of the MERS-CoV inhibitor peptides and a carrier, or they may include one or more expression systems capable of promoting cellular expression of one or more MERS-CoV inhibitor peptides. The MERS-CoV inhibitor peptides may also be used as reagents for MERS-CoV inhibition assays as a standard or reference inhibitors.

Abstract: The MERS-CoV inhibitor peptides include a set of peptides designed by modification or mutation of a wild type MERS-CoV fusion protein. The MERS-CoV inhibitor peptides are capable of inhibition of MERS-CoV membrane fusion, and thereby may prevent or slow the spread of MERS-CoV infections. Thus, the MERS-CoV inhibitor peptides may be used in pharmaceuticals to prevent and/or treat MERS-CoV infection. The pharmaceuticals may be formulated to comprise at least one of the MERS-CoV inhibitor peptides and a carrier, or they may include one or more expression systems capable of promoting cellular expression of one or more MERS-CoV inhibitor peptides. The MERS-CoV inhibitor peptides may also be used as reagents for MERS-CoV inhibition assays as a standard or reference inhibitors.