Abstract: The invention relates to single domain VHH fragments which specifically bind to and inhibit superoxide dismutase and/or bind to and inhibit catalase and/or bind to and inhibit superoxide dismutase and catalase, in particular for the use in the therapy of tumor diseases.

Abstract: The invention relates to single domain VHH fragments which specifically bind to and inhibit superoxide dismutase and/or bind to and inhibit catalase and/or bind to and inhibit superoxide dismutase and catalase, in particular for the use in the therapy of tumor diseases.

Abstract: The present invention concerns a polypeptide which is composed of the amino acids 1207±10 to 1488±10 of a hepatitis C virus and of less than 20 foreign amino acids and the use of this polypeptide as an antigen in an immunological test.

Abstract: In the area of virus diagnosis, in particular Epstein-Barr virus (EBV) diagnosis, methods for the detection of EBV and agents suitable for this purpose are provided, including peptides which are derived from p18-VCA and permit discrimination between acute and past EBV infection.

Abstract: The present invention concerns a polypeptide which is composed of the amino acids 1207±10 to 1488±10 of a hepatitis C virus and of less than 20 foreign amino acids and the use of this polypeptide as an antigen in an immunological test.

Abstract: Various immunologically active proteins from Borrelia burgdorferi have been prepared by genetic manipulation in microorganisms. To do this, the specific DNA sequences were selected from a B. burgdorferi gene bank using suitable screening methods, or were prepared directly by DNA amplification using selected hybridization probes, and were placed under the control of inducible promoters such as, for example, the lac promoter. It has been possible, owing to description of efficient purification methods for the expressed antigens, to provide the proteins in a suitable way. These proteins can be used to produce specific and sensitive diagnostic assay kits. The specific combination of the immunologically active proteins makes precise diagnosis possible. Furthermore, monoclonal antibodies have been generated and are used as reagents for detecting pathogens directly in test samples or after cultivation.

Abstract: In the area of virus diagnosis, in particular Epstein-Barr virus (EBV) diagnosis, methods for the detection of EBV and agents suitable for this purpose are provided, including peptides which are derived from p18-VCA and permit discrimination between acute and past EBV infection.

Abstract: The present invention concerns a polypeptide which is composed of the amino acids 1207±10 to 1488±10 of a hepatitis C virus and of less than 20 foreign amino acids and the use of this polypeptide as an antigen in an immunological test.

Abstract: Various immunologically active proteins from Borrelia burgdorferi have been prepared by genetic manipulation in microorganisms. To do this, the specific DNA sequences were selected from a B. burgdorferi gene bank using suitable screening methods, or were prepared directly by DNA amplification using selected hybridization probes, and were placed under the control of inducible promoters such as, for example, the lac promoter. It has been possible, owing to description of efficient purification methods for the expressed antigens, to provide the proteins in a suitable way. These proteins can be used to produce specific and sensitive diagnostic assay kits. The specific combination of the immunologically active proteins makes precise diagnosis possible. Furthermore, monoclonal antibodies have been generated and are used as reagents for detecting pathogens directly in test samples or after cultivation.

Abstract: The present invention relates to immunologically active proteins from Borrelia burgdorferi which are present in a form which is free of other proteins derived from Borrelia burgdorferi and which exhibit the sequence of the protein 1829-22A, which has the amino acid sequence (SEQ. ID NO:1) MKKFNLIIEALFAILLTACNFGLMEETKIALESSSKDVKNKILQIKKDAE DKGVNFAAFTSSETGSKVTNGGLALREAKIQAINEVEKFLKRIEEEALKL KEHGNSGQFLELFDLLLEVLESLEPIGIKGLKDFISEEAKCNPISTSER LIEVKVQIENKMEEVKRKQNLNKERKSNKGKKKK or a part sequence therefor having at least 10 consecutive amino acids, or exhibit the sequence of the protein 1829-22B, which has the amino acid sequence (SEQ.

Abstract: Various immunologically active proteins from Borrelia burgdorferi have been prepared by genetic manipulation in microorganisms. To do this, the specific DNA sequences were selected from a B. burgdorferi gene bank using suitable screening methods, or were prepared directly by DNA amplification using selected hybridization probes, and were placed under the control of inducible promoters such as, for example, the lac promoter. It has been possible, owing to description of efficient purification methods for the expressed antigens, to provide the proteins in a suitable way. These proteins can be used to produce specific and sensitive diagnostic assay kits. The specific combination of the immunologically active proteins makes precise diagnosis possible. Furthermore, monoclonal antibodies have been generated and are used as reagents for detecting pathogens directly in test samples or after cultivation.

Abstract: The present invention relates to immunologically active proteins from Borrelia burgdorferi which are present in a form which is free of other proteins derived from Borrelia burgdorferi and which exhibit the sequence of the protein 1829-22A, which has the amino acid sequence 1 MKKFNLIIEALFAILLTACNFGLMEETKIALESSSKDVKNKILQIKKDAE DKGVNFAAFTSSETGSKVTNGCLALREAKIQAINEVEKFLKRIEEEALKL KEHGNSGQFLELFDLLLEVLESLEPIGIKGLKDFIISEEAKCNPISTSER LIEVKVQIENKMEEVKRKQNLNKERKSNKGKKKK

Abstract: The present invention relates to immunologically active proteins from Borrelia burgdorferi which are present in a form which is free of other proteins derived from Borrelia burgdorferi and which exhibit the sequence of the protein 1829-22A, which has the amino acid sequence MKKFNLIIEALFAILLTACNFGLMEETKIALESSSKDVKNKILQIKKDAEDKGVNFAAFTSSETG SKVTNGGLALREAKIQAINEVEKFLKRIEEEALKLKEHGNSGQFLELFDLLLEVLESLEPIGIKG LKDFISEEAKCNPISTSERLIEVKVQIENKMEEVKRKQNLNKERKSNKGKKKK SEQ. ID NO.: 1 or a part sequence thereof having at least 10 consecutive amino acids, or exhibit the sequence of the protein 1829-22B, which has the amino acid sequence MIKYNKIILTLTLLASLLAACSLTGKARLESSVKDITNEIEKAIKEAEDAGVKTDAFTETQTGGK VAGPKIRAAKIRVADLTIKFLEATEEETITFKENGAGEDEFSGIYDLILNAAKAVEKIGMKDMTK TVEEAAKENPKTTANGIIEIVKVMKAKVENIKEKQTKNQK SEQ. ID NO.: 2 or a part sequence thereof having at least 10 consecutive amino acids.

Abstract: Various immunologically active proteins from Borrelia burgdorferi have been prepared by genetic manipulation in microorganisms. To do this, the specific DNA sequences were selected from a B. burgdorferi gene bank using suitable screening methods, or were prepared directly by DNA amplification using selected hybridization probes, and were placed under the control of inducible promoters such as, for example, the lac promoter. It has been possible, owing to description of efficient purification methods for the expressed antigens, to provide the proteins in a suitable way. These proteins can be used to produce specific and sensitive diagnostic assay kits. The specific combination of the immunologically active proteins makes precise diagnosis possible. Furthermore, monoclonal antibodies have been generated and are used as reagents for detecting pathogens directly in test samples or after cultivation.

Abstract: The present invention concerns a polypeptide which is composed of the amino acids 1207±10 to 1488±10 of a hepatitis C virus and of less than 20 foreign amino acids and the use of this polypeptide as an antigen in an immunological test.

Abstract: Various immunologically active proteins from Borrelia burgdorferi have been prepared by genetic manipulation in microorganisms. To do this, the specific DNA sequences were selected from a B. burgdorferi gene bank using suitable screening methods, or were prepared directly by DNA amplification using selected hybridization probes, and were placed under the control of inducible promoters such as, for example, the lac promoter. It has been possible, owing to description of efficient purification methods for the expressed antigens, to provide the proteins in a suitable way. These proteins can be used to produce specific and sensitive diagnostic assay kits. The specific combination of the immunologically active proteins makes precise diagnosis possible. Furthermore, monoclonal antibodies have been generated and are used as reagents for detecting pathogens directly in test samples or after cultivation.

Abstract: The present invention concerns a polypeptide which is composed of the amino acids 1207±10 to 1488±10 of a hepatitis C virus and of less than 20 foreign amino acids and the use of this polypeptide as an antigen in an immunological test.

Abstract: Immunologically active peptides or polypeptides with a partial amino-acid sequence of the capsid proteins VP1 and VP2 of parvovirus B19 which permit tests to be carried out at low cost, sensitively and specifically for the determination of antibodies against human parvovirus B19 are made available. Short peptide sequences which, employed as antigen, serve to identify anti-B19 IgG-positive sera are identified. Furthermore, the production of these peptides using genetic engineering measures is disclosed. Other antigens which are produced by genetic engineering and which can be stably produced in a high yield in E.coli and subsequently purified therefrom are used as additional antigens for IgG detection. Finally, a set of antigens permits tests to be carried out to determine IgM antibodies against the virus. In addition, the components, produced by genetic engineering, of the surface proteins represent substances which can be used for prophylactic immunisation.

Abstract: The present invention concerns a polypeptide which is composed of the amino acids 1207±10 to 1488±10 of a hepatitis C virus and of less than 20 foreign amino acids and the use of this polypeptide as an antigen in an immunological test.

Abstract: Various immunologically active proteins from Borrelia burgdorferi have been prepared by genetic manipulation in microorganisms. To do this, the specific DNA sequences were selected from a B. burgdorferi gene bank using suitable screening methods, or were prepared directly by DNA amplification using selected hybridization probes, and were placed under the control of inducible promoters such as, for example, the lac promoter. It has been possible, owing to description of efficient purification methods for the expressed antigens, to provide the proteins in a suitable way. These proteins can be used to produce specific and sensitive diagnostic assay kits. The specific combination of the immunologically active proteins makes precise diagnosis possible. Furthermore, monoclonal antibodies have been generated and are used as reagents for detecting pathogens directly in test samples or after cultivation.