Patents by Inventor Mathias Gebhart

Mathias Gebhart has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • CETP fragments
    Patent number: 9085636
    Abstract: The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.
    Type: Grant
    Filed: June 11, 2012
    Date of Patent: July 21, 2015
    Assignee: AFFIRIS AG
    Inventors: Sylvia Brunner, Mathias Gebhart, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh
  • CETP FRAGMENTS
    Publication number: 20140147456
    Abstract: The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.
    Type: Application
    Filed: June 11, 2012
    Publication date: May 29, 2014
    Applicant: AFFIRIS AG
    Inventors: Sylvia Brunner, Mathias Gebhart, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh