Abstract: The invention concerns a pharmaceutical composition for treating and/or preventing cancer comprising at least an anti-cancer agent, characterised in that said anticancer agent is associated in the composition with at least a peptide capable of carrying said agent into the cancer cells and prevent the occurrence of chemoresistance to said agent.

Abstract: The invention concerns the use of a linear peptide paired with an active substance for diagnosing or treating a CNS pathology by preparing a medicine capable of crossing the blood brain barrier to be used for diagnosis or treatment of a pathology localized in the CNS.

Abstract: The invention relates to conjugates of an antigen coupled to a linear derivative of a ?-stranded antibiotic peptide, which are useful for immunogenic agents to enhance a CTL response. Two groups of preferred peptides are derived from the antibiotics protegrin and tachyplesin.

Abstract: A peptide molecule that interferes with an HLH domain of TAL-1 including at least 10 successive amino acids from the HLH domain of TAL-1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1) or an equivalent sequence; and a pharmaceutical composition comprising at least one peptide molecule as an active ingredient, and an acceptable vehicle.

Abstract: The present invention is concerned with a computer-aided method for the provision, identification and description of molecules exhibiting a desired behaviour, more particularly in the pharmaceutical sector, employing a molecular modelling step, a combinatorial library building step and a step of selecting potentially useful molecules, said method including a step whereby the candidate molecules are filtered using a dynamic filter representing constraints of conformational variations which the molecules must satisfy in order to exhibit said activity.

Abstract: Recombinant baculovirus used as an expression vector in the production of immunoglobulins with an insect cell. The invention is characterized by a first expression cassette comprising a first sequence coding for at least one portion of an immunoglobulin heavy chain, wherein the sequence is transcriptionally controlled by a first baculovirus promoter, and a second expression cassette comprising a second sequence coding for at least one portion of an immunoglobulin light chain, said second sequence being transcriptionally controlled by a second baculovirus promoter. The first and second promoters are two different promoters or derivatives of different promoters, the first and second promoters residing at different loci.

Abstract: The invention relates to conjugates of an antigen coupled to a linear derivative of a &bgr;-stranded antibiotic peptide, which are useful for immunogenic agents to enhance a CTL response. Two groups of preferred peptides are derived from the antibiotics protegrin and tachyplesin.

Abstract: Cloning of DNA fragments which code for the light chain or the heavy chain variable domain of the D7C2 monoclonal antibody within a baculovirus. The invention also concerns the expression of these DNA fragments in insect host cells, the anti-rhesus D recombinant monoclonal antibody so obtained and its use.