Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami

Abstract: Provided herein are anti-LTBR multispecific binding molecules, nucleic acids encoding the anti-LTBR multispecific binding molecules, vectors comprising the nucleic acids, host cells comprising the vectors, and pharmaceutical compositions comprising the anti-LTBR multispecific binding molecules. Also provided are methods of treating cancer in a subject in need thereof, the methods comprising administering the pharmaceutical compositions disclosed herein.

Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami

Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami

Abstract: Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.

Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami

Abstract: Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.

Abstract: The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.

Abstract: The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.

Abstract: The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.

Abstract: The present invention relates to immunoconjugates. In particular embodiments, the present invention relates to immunoconjugates comprising at least one single-chain effector moiety and two or more antigen binding moieties. In addition, the present invention relates to nucleic acid molecules encoding such immunoconjugates, vectors and host cells comprising such nucleic acid molecules. The invention further relates to methods for producing the immunoconjugates of the invention, and to methods of using these immunoconjugates in the treatment of disease.

Abstract: The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.

Abstract: Specific binding members against extracellular matrix protein tenascin-C, especially scFv antibody molecules against domain A1, domain C and domain D of tenascin-C. Anti-tenascin-C specific binding members conjugated with labels, cytotoxic molecules or cytokines. Use of anti-tenascin-C specific binding members in diagnosis and treatment, especially of cancer.

Abstract: The present invention relates to immunoconjugates. In particular embodiments, the present invention relates to immunoconjugates comprising at least one single-chain effector moiety and two or more antigen binding moieties. In addition, the present invention relates to nucleic acid molecules encoding such immunoconjugates, vectors and host cells comprising such nucleic acid molecules. The invention further relates to methods for producing the immunoconjugates of the invention, and to methods of using these immunoconjugates in the treatment of disease.

Abstract: Specific binding members against extracellular matrix protein tenascin-C, especially scFv antibody molecules against domain A1, domain C and domain D of tenascin-C. Anti-tenascin-C specific binding members conjugated with labels, cytotoxic molecules or cytokines. Use of anti-tenascin-C specific binding members in diagnosis and treatment, especially of cancer.