Patents by Inventor Michela Silacci

Michela Silacci has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20250101123
    Abstract: Provided herein are anti-LTBR multispecific binding molecules, nucleic acids encoding the anti-LTBR multispecific binding molecules, vectors comprising the nucleic acids, host cells comprising the vectors, and pharmaceutical compositions comprising the anti-LTBR multispecific binding molecules. Also provided are methods of treating cancer in a subject in need thereof, the methods comprising administering the pharmaceutical compositions disclosed herein.
    Type: Application
    Filed: December 6, 2024
    Publication date: March 27, 2025
    Applicant: Cilag GmbH International
    Inventors: Matthew LORENZI, Sylvie LAQUERRE, Simon BRACK, Kristina KLUPSCH, Babette SCHADE, Vanessa BAERISWYL, Michela SILACCI MELKKO, Julian BERTSCHINGER
  • Patent number: 11351267
    Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami
    Type: Grant
    Filed: June 15, 2020
    Date of Patent: June 7, 2022
    Assignee: Cilag GMBH International
    Inventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
  • Publication number: 20210188990
    Abstract: Provided herein are anti-LTBR multispecific binding molecules, nucleic acids encoding the anti-LTBR multispecific binding molecules, vectors comprising the nucleic acids, host cells comprising the vectors, and pharmaceutical compositions comprising the anti-LTBR multispecific binding molecules. Also provided are methods of treating cancer in a subject in need thereof, the methods comprising administering the pharmaceutical compositions disclosed herein.
    Type: Application
    Filed: December 10, 2020
    Publication date: June 24, 2021
    Inventors: Matthew LORENZI, Sylvie LAQUERRE, Simon BRACK, Kristina KLUPSCH, Babette SCHADE, Vanessa BAERISWYL, Michela SILACCI MELKKO, Julian BERTSCHINGER
  • Publication number: 20200345859
    Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami
    Type: Application
    Filed: June 15, 2020
    Publication date: November 5, 2020
    Applicant: Covagen AG
    Inventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
  • Patent number: 10722589
    Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami
    Type: Grant
    Filed: April 2, 2018
    Date of Patent: July 28, 2020
    Assignee: Covagen AG
    Inventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
  • Patent number: 10323095
    Abstract: Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.
    Type: Grant
    Filed: March 16, 2015
    Date of Patent: June 18, 2019
    Assignee: MITSUBISHI TANABE PHARMA CORPORATION
    Inventors: Roland Newman, Steve Granger, Michael Lyman, Dragan Grabulovski, Richard Woods, Michela Silacci, Wenjuan Zha, Isabella Attinger-Toller
  • Publication number: 20180280527
    Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami
    Type: Application
    Filed: April 2, 2018
    Publication date: October 4, 2018
    Applicant: Covagen AG
    Inventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
  • Publication number: 20170081412
    Abstract: Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.
    Type: Application
    Filed: March 16, 2015
    Publication date: March 23, 2017
    Applicant: MITSUBISHI TANABE PHARMA CORPORATION
    Inventors: Roland NEWMAN, Steve GRANGER, Michael LYMAN, Dragan GRABULOVSKI, Richard WOODS, Michela SILACCI, Wenjuan ZHA, Isabella ATTINGER-TOLLER
  • Publication number: 20160368957
    Abstract: The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.
    Type: Application
    Filed: May 17, 2016
    Publication date: December 22, 2016
    Inventors: Dragan GRABULOVSKI, Michela Silacci Melkko, Frederic Mourlane, Simon Sebastian Brack, Julian Bertschinger, Nadia Beaenziger, Sarah Batey
  • Patent number: 9376477
    Abstract: The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.
    Type: Grant
    Filed: August 24, 2010
    Date of Patent: June 28, 2016
    Assignee: Covagen AG
    Inventors: Dragan Grabulovski, Michela Silacci Melkko, Frédéric Mourlane, Simon Sebastian Brack, Julian Bertschinger, Nadja Baenziger, Sarah Batey
  • Publication number: 20150322125
    Abstract: The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.
    Type: Application
    Filed: September 19, 2013
    Publication date: November 12, 2015
    Inventors: Michela SILACCI MELKKO, Nadja BANZIGER, Richard WOODS, Wenjuan ZHA, Isabella ATTINGER, Roger SANTIMARIA, Wibke LEMBKE, Sarah BATEY, Ulrike VON DER BEY, Julian BERTSCHINGER, Dragan GRABULOVSKI
  • Patent number: 8945571
    Abstract: The present invention relates to immunoconjugates. In particular embodiments, the present invention relates to immunoconjugates comprising at least one single-chain effector moiety and two or more antigen binding moieties. In addition, the present invention relates to nucleic acid molecules encoding such immunoconjugates, vectors and host cells comprising such nucleic acid molecules. The invention further relates to methods for producing the immunoconjugates of the invention, and to methods of using these immunoconjugates in the treatment of disease.
    Type: Grant
    Filed: August 17, 2010
    Date of Patent: February 3, 2015
    Assignee: Roche GlyeArt AG
    Inventors: Ekkehard Mössner, Ralf Jörg Hosse, Pablo Umaña, Michela Silacci-Melkko
  • Publication number: 20130005659
    Abstract: The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.
    Type: Application
    Filed: August 24, 2010
    Publication date: January 3, 2013
    Applicant: Covagen AG
    Inventors: Dragan Grabulovski, Michela Silacci Melkko, Frédéric Mourlane, Simon Sebastian, Julian Bertschinger, Nadja Baenziger, Sarah Batey
  • Patent number: 7968685
    Abstract: Specific binding members against extracellular matrix protein tenascin-C, especially scFv antibody molecules against domain A1, domain C and domain D of tenascin-C. Anti-tenascin-C specific binding members conjugated with labels, cytotoxic molecules or cytokines. Use of anti-tenascin-C specific binding members in diagnosis and treatment, especially of cancer.
    Type: Grant
    Filed: October 31, 2005
    Date of Patent: June 28, 2011
    Assignee: Philogen S.p.A.
    Inventors: Simon Brack, Michela Silacci, Dario Neri
  • Publication number: 20110064751
    Abstract: The present invention relates to immunoconjugates. In particular embodiments, the present invention relates to immunoconjugates comprising at least one single-chain effector moiety and two or more antigen binding moieties. In addition, the present invention relates to nucleic acid molecules encoding such immunoconjugates, vectors and host cells comprising such nucleic acid molecules. The invention further relates to methods for producing the immunoconjugates of the invention, and to methods of using these immunoconjugates in the treatment of disease.
    Type: Application
    Filed: August 17, 2010
    Publication date: March 17, 2011
    Applicant: Roche GlycArt AG
    Inventors: Ekkehard Mössner, Ralf Jörg Hosse, Pablo Umaña, Michela Silacci-Melkko
  • Publication number: 20080056997
    Abstract: Specific binding members against extracellular matrix protein tenascin-C, especially scFv antibody molecules against domain A1, domain C and domain D of tenascin-C. Anti-tenascin-C specific binding members conjugated with labels, cytotoxic molecules or cytokines. Use of anti-tenascin-C specific binding members in diagnosis and treatment, especially of cancer.
    Type: Application
    Filed: October 31, 2005
    Publication date: March 6, 2008
    Applicant: PHILOGEN S.P.A.
    Inventors: Simon Brack, Michela Silacci, Dario Neri