Patents by Inventor Michela Silacci
Michela Silacci has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).
-
Publication number: 20250101123Abstract: Provided herein are anti-LTBR multispecific binding molecules, nucleic acids encoding the anti-LTBR multispecific binding molecules, vectors comprising the nucleic acids, host cells comprising the vectors, and pharmaceutical compositions comprising the anti-LTBR multispecific binding molecules. Also provided are methods of treating cancer in a subject in need thereof, the methods comprising administering the pharmaceutical compositions disclosed herein.Type: ApplicationFiled: December 6, 2024Publication date: March 27, 2025Applicant: Cilag GmbH InternationalInventors: Matthew LORENZI, Sylvie LAQUERRE, Simon BRACK, Kristina KLUPSCH, Babette SCHADE, Vanessa BAERISWYL, Michela SILACCI MELKKO, Julian BERTSCHINGER
-
Patent number: 11351267Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amiType: GrantFiled: June 15, 2020Date of Patent: June 7, 2022Assignee: Cilag GMBH InternationalInventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
-
Publication number: 20210188990Abstract: Provided herein are anti-LTBR multispecific binding molecules, nucleic acids encoding the anti-LTBR multispecific binding molecules, vectors comprising the nucleic acids, host cells comprising the vectors, and pharmaceutical compositions comprising the anti-LTBR multispecific binding molecules. Also provided are methods of treating cancer in a subject in need thereof, the methods comprising administering the pharmaceutical compositions disclosed herein.Type: ApplicationFiled: December 10, 2020Publication date: June 24, 2021Inventors: Matthew LORENZI, Sylvie LAQUERRE, Simon BRACK, Kristina KLUPSCH, Babette SCHADE, Vanessa BAERISWYL, Michela SILACCI MELKKO, Julian BERTSCHINGER
-
Publication number: 20200345859Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amiType: ApplicationFiled: June 15, 2020Publication date: November 5, 2020Applicant: Covagen AGInventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
-
Patent number: 10722589Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amiType: GrantFiled: April 2, 2018Date of Patent: July 28, 2020Assignee: Covagen AGInventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
-
Patent number: 10323095Abstract: Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.Type: GrantFiled: March 16, 2015Date of Patent: June 18, 2019Assignee: MITSUBISHI TANABE PHARMA CORPORATIONInventors: Roland Newman, Steve Granger, Michael Lyman, Dragan Grabulovski, Richard Woods, Michela Silacci, Wenjuan Zha, Isabella Attinger-Toller
-
Publication number: 20180280527Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amiType: ApplicationFiled: April 2, 2018Publication date: October 4, 2018Applicant: Covagen AGInventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
-
Publication number: 20170081412Abstract: Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.Type: ApplicationFiled: March 16, 2015Publication date: March 23, 2017Applicant: MITSUBISHI TANABE PHARMA CORPORATIONInventors: Roland NEWMAN, Steve GRANGER, Michael LYMAN, Dragan GRABULOVSKI, Richard WOODS, Michela SILACCI, Wenjuan ZHA, Isabella ATTINGER-TOLLER
-
Publication number: 20160368957Abstract: The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.Type: ApplicationFiled: May 17, 2016Publication date: December 22, 2016Inventors: Dragan GRABULOVSKI, Michela Silacci Melkko, Frederic Mourlane, Simon Sebastian Brack, Julian Bertschinger, Nadia Beaenziger, Sarah Batey
-
Patent number: 9376477Abstract: The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.Type: GrantFiled: August 24, 2010Date of Patent: June 28, 2016Assignee: Covagen AGInventors: Dragan Grabulovski, Michela Silacci Melkko, Frédéric Mourlane, Simon Sebastian Brack, Julian Bertschinger, Nadja Baenziger, Sarah Batey
-
Publication number: 20150322125Abstract: The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.Type: ApplicationFiled: September 19, 2013Publication date: November 12, 2015Inventors: Michela SILACCI MELKKO, Nadja BANZIGER, Richard WOODS, Wenjuan ZHA, Isabella ATTINGER, Roger SANTIMARIA, Wibke LEMBKE, Sarah BATEY, Ulrike VON DER BEY, Julian BERTSCHINGER, Dragan GRABULOVSKI
-
Patent number: 8945571Abstract: The present invention relates to immunoconjugates. In particular embodiments, the present invention relates to immunoconjugates comprising at least one single-chain effector moiety and two or more antigen binding moieties. In addition, the present invention relates to nucleic acid molecules encoding such immunoconjugates, vectors and host cells comprising such nucleic acid molecules. The invention further relates to methods for producing the immunoconjugates of the invention, and to methods of using these immunoconjugates in the treatment of disease.Type: GrantFiled: August 17, 2010Date of Patent: February 3, 2015Assignee: Roche GlyeArt AGInventors: Ekkehard Mössner, Ralf Jörg Hosse, Pablo Umaña, Michela Silacci-Melkko
-
Publication number: 20130005659Abstract: The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.Type: ApplicationFiled: August 24, 2010Publication date: January 3, 2013Applicant: Covagen AGInventors: Dragan Grabulovski, Michela Silacci Melkko, Frédéric Mourlane, Simon Sebastian, Julian Bertschinger, Nadja Baenziger, Sarah Batey
-
Patent number: 7968685Abstract: Specific binding members against extracellular matrix protein tenascin-C, especially scFv antibody molecules against domain A1, domain C and domain D of tenascin-C. Anti-tenascin-C specific binding members conjugated with labels, cytotoxic molecules or cytokines. Use of anti-tenascin-C specific binding members in diagnosis and treatment, especially of cancer.Type: GrantFiled: October 31, 2005Date of Patent: June 28, 2011Assignee: Philogen S.p.A.Inventors: Simon Brack, Michela Silacci, Dario Neri
-
Publication number: 20110064751Abstract: The present invention relates to immunoconjugates. In particular embodiments, the present invention relates to immunoconjugates comprising at least one single-chain effector moiety and two or more antigen binding moieties. In addition, the present invention relates to nucleic acid molecules encoding such immunoconjugates, vectors and host cells comprising such nucleic acid molecules. The invention further relates to methods for producing the immunoconjugates of the invention, and to methods of using these immunoconjugates in the treatment of disease.Type: ApplicationFiled: August 17, 2010Publication date: March 17, 2011Applicant: Roche GlycArt AGInventors: Ekkehard Mössner, Ralf Jörg Hosse, Pablo Umaña, Michela Silacci-Melkko
-
Publication number: 20080056997Abstract: Specific binding members against extracellular matrix protein tenascin-C, especially scFv antibody molecules against domain A1, domain C and domain D of tenascin-C. Anti-tenascin-C specific binding members conjugated with labels, cytotoxic molecules or cytokines. Use of anti-tenascin-C specific binding members in diagnosis and treatment, especially of cancer.Type: ApplicationFiled: October 31, 2005Publication date: March 6, 2008Applicant: PHILOGEN S.P.A.Inventors: Simon Brack, Michela Silacci, Dario Neri