Abstract: The present invention provides polypeptides having a length of up to 180 amino acids and containing a sequence selected from sequences identical or differing at most in 5 amino acids from the sequence: KSELAVEILEKGQVRFWMQAX21X22X23X24GNAKVNYIFNEKEIFEGPKYKMHIDXsoXsiXszGIIEM FMEKLQDEDEGTYTFQLQX76X77X78X79X80NHSTVVLVGDVFKKLQKEAEFQRQEWIRKQG (SEQ ID NO. 2), wherein X21X22X23X24 is selected from KAQQ (SEQ ID NO. 33), LSVF (SEQ ID NO. 34), ATPS (SEQ ID NO. 35), EIMW (SEQ ID NO. 36), DGSS (SEQ ID NO. 37), LLPL (SEQ ID NO. 38), WMWW (SEQ ID NO. 39), MNLY (SEQ ID NO. 40), MWRN (SEQ ID NO. 41), IMME (SEQ ID NO. 42), KHQL (SEQ ID NO. 43), HWQF (SEQ ID NO. 44), YAGN (SEQ ID NO. 45) and HGQW (SEQ ID NO. 46); X50X51X52 is selected from RNT, IMF, GHE, PSW, RAN, YFW, ITL, QAM, DMR, WLW, QGE, VQY and VSL; X76X77X78X79X80 is selected from SHHLG (SEQ ID NO. 47), FMLMM (SEQ ID NO. 48), VILIL (SEQ ID NO. 49), IVTPL (SEQ ID NO. 50), DFIIW (SEQ ID NO. 51), MWSE (deletion) (SEQ ID NO. 52), LYYAW (SEQ ID NO. 53), MMIEY (SEQ ID NO.

Abstract: A polypeptide mimicking epitope of glycoprotein gp120 of HIV-1 virus that is recognized by a paratope of broadly neutralizing antibody VRC01 and has the length up to 100 amino acid residues and contains an amino acid sequence: (SEQ?ID?NO.?1): X1YKNX2INX3AX4X5VX6X7VKRX8IDX9ILAX10LP X1 is selected from amino acids A, N, R; X2 is selected from amino acids A, R, D; X3 is selected from amino acids R, V, P; X4 is selected from amino acids V, L, S; X5 is selected from amino acids T, G, R; X6 is selected from amino acids G, T; X7 is selected from amino acids L, A; X8 is selected from amino acids V, I; X9 is selected from amino acids G, A, R; X10 is selected from amino acids R, A, G; with a directly attached alpha-helical structure at the N-terminus or C-terminus is disclosed.

Abstract: The present invention relates to a mucoadhesive carrier system, for particles, which comprises nanoscaffold having a nanofibrous layer with a thickness of from 0.1 to 1000 ?m, carrying a substance in the form of particles. The mucoadhesive layer, in at least a part of its surface, overlaps the nanoscaffold. A process for its preparation and its use for delivery of the vaccines and therapeutics to mucosal surfaces is also disclosed.