Abstract: The invention relates to antibody fusion proteins. Particularly, the invention relates to antibody fusion proteins for intra-cellular and intra-nucleus drugs delivery. The fusion protein of the invention can be used as a peptide penetration system that specifically binds to various targets for the delivery of effector peptides across a biological barrier.

Abstract: The invention provides Dsg2-derived peptides for inhibiting EMT and/or vasculogenic mimicry and treating and/or preventing angiogenesis-related diseases. Also provided are pharmaceutical compositions comprising the peptide of the invention and methods of using the peptide of the invention in inhibiting EMT and/or vasculogenic mimicry, and treating and/or preventing angiogenesis-related diseases.

Abstract: The invention provides antibodies against the antigen containing the Dsg2 extracellular domain 2. Also provided is the method of using the antibodies in treatment or prevention of a cancer.

Abstract: The invention relates to antibody fusion proteins. Particularly, the invention relates to antibody fusion proteins for intra-cellular and intra-nucleus drugs delivery. The fusion protein of the invention can be used as a peptide penetration system that specifically binds to various targets for the delivery of effector peptides across a biological barrier.

Abstract: The invention provides antibodies against the antigen containing the Dsg2 extracellular domain 2. Also provided is the method of using the antibodies in treatment or prevention of a cancer.

Abstract: The invention provides Dsg2-derived peptides for inhibiting EMT and/or vasculogenic mimicry and treating and/or preventing angiogenesis-related diseases. Also provided are pharmaceutical compositions comprising the peptide of the invention and methods of using the peptide of the invention in inhibiting EMT and/or vasculogenic mimicry, and treating and/or preventing angiogenesis-related diseases.

Abstract: Disclosed herein are methods for treating an angiogenesis-related condition or disease in a subject in need thereof. Said method includes administering to the subject a peptide having at least 90% sequence identity of the sequence of SEQ ID NO: 1 or SEQ ID NO:3 in a therapeutically effective amount.

Abstract: Disclosed herein are methods for treating an angiogenesis-related condition or disease in a subject in need thereof. Said method includes administering to the subject a peptide having at least 90% sequence identity of the sequence of SEQ ID NO: 1 or SEQ ID NO:3 in a therapeutically effective amount.

Abstract: The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGS VEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.

Abstract: The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.

Abstract: A planar antenna and a handheld device are provided. The handheld device includes the planar antenna and a system ground plane. The planar antenna has a first feed point, a first ground point, a second feed point, and a second ground point. The first ground point and the second ground point are located between the first feed point and the second feed point. The system ground plane is electrically connected to the first feed point, the first ground point, the second feed point, and the second ground point. Thereby, the performance in radio signal transceiving is improved.

Abstract: A PIFA/monopole hybrid antenna includes a high-frequency radiator, a low-frequency radiator, a connecting part, a feed part, and a ground part. The high-frequency radiator includes a first radiating part and a second radiating part extended substantially perpendicular to the first radiating part. The low-frequency radiator includes a third radiating part extended substantially parallel to the first radiating part, and a fourth radiating part extended substantially perpendicular to the third radiating part. The connecting part is connected between the high-frequency radiator, the low-frequency radiator, the connecting part, the feed part, and the ground part.

Abstract: A PIFA for a thin communication apparatus is provided. The PIFA includes a main body, a ground area and two ground segments, wherein the ground segments are adjacent with each other and extending out from a same side of the ground area. The SAR value and a required height for setting the antenna can be reduced through the design of two grounding paths on the antenna.

Abstract: The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGS VEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.

Abstract: A planar antenna and a handheld device are provided. The handheld device includes the planar antenna and a system ground plane. The planar antenna has a first feed point, a first ground point, a second feed point, and a second ground point. The first ground point and the second ground point are located between the first feed point and the second feed point. The system ground plane is electrically connected to the first feed point, the first ground point, the second feed point, and the second ground point. Thereby, the performance in radio signal transceiving is improved.

Abstract: An antenna device including a ground plane, a circuit board, an antenna, and a conductive wire is provided. The circuit board includes a signal feed point, and the antenna includes a radiation portion and a feed portion extending externally from the radiation portion. The feed portion is electrically connected to the signal feed point, and the conductive wire is disposed on the circuit board and electrically connected to the ground plane and the signal feed point. The conductive wire is, for example, a printed trace formed on the circuit board.

Abstract: A mobile communications device includes a circuit board and a monopole antenna. The monopole antenna includes a feed part electrically connected to the circuit board and directed away from the circuit board at an acute angle, a connecting part extending from the feed part in a direction substantially perpendicular to the circuit board, a first radiating part extending from the connecting part, and a second radiating part also extending from the connecting part.

Abstract: An antenna module, a speaker and a portable electronic device are provided, wherein the portable electronic device comprises the antenna module, the speaker and a circuit board. The antenna module comprises a main portion and a connecting portion, wherein the main portion of the antenna module comprises at least one portion of a metal shield of the speaker, and the connecting portion electrically connects the circuit board and the main portion.

Abstract: An antenna device including a ground plane, a circuit board, an antenna, and a conductive wire is provided. The circuit board includes a signal feed point, and the antenna includes a radiation portion and a feed portion extending externally from the radiation portion. The feed portion is electrically connected to the signal feed point, and the conductive wire is disposed on the circuit board and electrically connected to the ground plane and the signal feed point. The conductive wire is, for example, a printed trace formed on the circuit board.

Abstract: A PIFA for a thin communication apparatus is provided. The PIFA includes a main body, a ground area and two ground segments, wherein the ground segments are adjacent with each other and extending out from a same side of the ground area. The SAR value and a required height for setting the antenna can be reduced through the design of two grounding paths on the antenna.