Abstract: A peptide that can be used as an imaging probe for GLP-1R is provided. In an embodiment, a polypeptide is represented by the following formula (3); (Sequence ID No. 3) Xaa1-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg- Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser (3) where Xaa1 represents an aspartic acid in which a —Y—X? group binds to an ?-amino group, X? includes a chelating site and a radioactive metal nuclide chelated by the chelating site, the chelating site being diethylenetriaminepentaacetic dianhydride (DTPA) or 1,4,7-triazacyclononnane-N,N?,N?-triacetic acid (NOTA), and Y represents a linker including a group selected from the group consisting of —CH2—(C6H4)—, —NH—C(?S)—, —NH—(CH2)5—C(?O)—, and a combination thereof.

Abstract: Provided is a method for inducing pancreatic hormone-producing cells from pancreatic progenitor cells efficiently. The method comprises a step of culturing the cells in a culture medium comprising sodium cromoglicate.

Abstract: Provided is a method for inducing pancreatic hormone-producing cells from pancreatic progenitor cells efficiently. The method comprises a step of culturing the cells in a culture medium comprising sodium cromoglicate.

Abstract: A new peptide derivative is provided.

Abstract: A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ?ID?NO.?1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2?(1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.

Abstract: A peptide that can be used as an imaging probe for GLP-1R is provided. In an embodiment, a polypeptide is represented by the following formula (3); (Sequence ID No. 3) Xaa1-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg- Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser (3) where Xaa1 represents an aspartic acid in which a —Y—X? group binds to an ?-amino group, X? includes a chelating site and a radioactive metal nuclide chelated by the chelating site, the chelating site being diethylenetriaminepentaacetic dianhydride (DTPA) or 1,4,7-triazacyclononnane-N,N?,N?-triacetic acid (NOTA), and Y represents a linker including a group selected from the group consisting of —CH2—(C6H4)—, —NH—C(?S)—, —NH—(CH2)5—C(?O)—, and a combination thereof.

Abstract: A precursor of molecular probe for imaging of pancreatic islets is provided. A polypeptide represented by any one of the following formulae (1) to (4), or a polypeptide having a homology with the foregoing polypeptide. *-DESK*?QMEEEAVRLFIEVVLK*?NGGPSSGAPPPSK-NH2?(1) *-LSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2?(2) *-SK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2?(3) *-K*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2?(4), wherein *- indicates that an ?-amino group at an N-terminus is protected by a protecting group or modified with a modifying group having no electric charge; K* indicates that an amino group of a side chain of a lysine is protected by a protecting group; and —NH2 indicates that a carboxyl group at a C-terminus is amidated.

Abstract: A precursor of a molecular probe for imaging of pancreatic islets is provided.

Abstract: A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe comprises a polypeptide represented by the following formula (1), (2), or (3), or a polypeptide having homology with the foregoing polypeptide, (SEQ?ID?NO.?1) Z-HGEGTFTSDLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) (SEQ?ID?NO.?2) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(2) (SEQ?ID?NO.?3) B-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(3) where, in the formulae (1) and (2), “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a radioactive nuclide, and “Z—” indicates that an ?-amino group at an N-terminus is not modified, or is modified with a modifying group having no electric charge; in the formula (3), “B—” indicates that an ?-amino group at an N-terminus is labeled with a radioactive nuclide; and in the formulae (1), (2), and (3), “—NH2” indicates that a carboxyl group at a C-terminus is amidated.

Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.

Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2? (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.

Abstract: The present invention relates to a method for producing a polypeptide.

Abstract: A precursor of a molecular probe for imaging of pancreatic islets is a compound expressed as the following formula (I): wherein -V-X represents a substituent on a benzene ring, V represents a bond, R1, of OR1, R1 represents a C1-C6 alkylene group, R2 represents H (hydrogen atom), a C1-C6 alkyl group, a C7-C10 aralkyl group, or a protecting group, X represents a OMs group, a OTs group, a OTf group, Br (bromine atom), or I (iodine atom), and carbon marked with * is an asymmetric carbon atom.

Abstract: A new peptide derivative is provided.

Abstract: A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe comprises a polypeptide represented by the following formula (1), (2), or (3), or a polypeptide having homology with the foregoing polypeptide, (SEQ?ID?NO.?1) Z-HGEGTFTSDLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) (SEQ?ID?NO.?2) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(2) (SEQ?ID?NO.?3) B-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(3) where, in the formulae (1) and (2), “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a radioactive nuclide, and “Z—” indicates that an ?-amino group at an N-terminus is not modified, or is modified with a modifying group having no electric charge; in the formula (3), “B—” indicates that an ?-amino group at an N-terminus is labeled with a radioactive nuclide; and in the formulae (1), (2), and (3), “—NH2” indicates that a carboxyl group at a C-terminus is amidated.

Abstract: A precursor of a molecular probe for imaging of pancreatic islets is provided.

Abstract: A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ?ID?NO.?1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2?(1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.

Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides; polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides; Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2? (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (9) where X in the formulae (1) and (5) and B—in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.

Abstract: A precursor of molecular probe for imaging of pancreatic islets is provided. A polypeptide represented by any one of the following formulae (1) to (4), or a polypeptide having a homology with the foregoing polypeptide. *-DLSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (1) ?*-LSK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (2) ??*-SK*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2 (3) ???*-K*?QMEEEAVRLFIEWLK*?NGGPSSGAPPPSK-NH2, (4) wherein *- indicates that an ?-amino group at an N-terminus is protected by a protecting group or modified with a modifying group having no electric charge; K* indicates that an amino group of a side chain of a lysine is protected by a protecting group; and —NH2 indicates that a carboxyl group at a C-terminus is amidated.

Abstract: Heartbeat/respiration sensor 4 comprises flexible vibration transmitting plate 1 formed with a plurality of air vents 3, and piezoelectric transducer 2 mounted on vibration transmitting plate 1.