Abstract: A new method of synthesizing GLP-1 peptide is devised.

Abstract: A new method of synthesizing GLP-1 peptide is devised.

Abstract: A novel compound of formula I is devised.

Abstract: A novel method for synthesizing a Hirulog peptide is devised.

Abstract: Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively.

Abstract: A new method of anchoring a growing peptide chain during chemical synthesis to a solid-phase support is devised. Novel amino acid derivatives and peptide derivatives, both unbonded and bonded to a solid-phase support, are also provided.

Abstract: A new method of synthesizing GLP-1 peptide is devised.

Abstract: A novel method for synthesizing a Hirulog peptide is devised.

Abstract: A novel for amidation of C-terminal carboxyl groups of peptides is devised, which methods avoids undesired epimerisation of the ?-carbon of the C-terminal amino acid yielding diastereoisomeric variants of the amidated peptide.

Abstract: Method of peptide synthesis, comprising the steps of a. synthesizing a peptide linked to a solid phase which peptide comprises at least one cysteine, homo- or nor-cysteine residue, which cysteine is protected in its side chain by a S-tert.butyl-sulphenyl group b. either coupling N-terminally a further amino acid having a 3,3?-dithio-(1-carboxy-propyl)-propionyl-radical on its N? or deprotecting the N? of the N-terminal amino acid and reacting the free N? with 3,3?-dithio-propionic acid imide to yield the corresponding N?-3,3?-dithio-(1-carboxy-propyl)-propionamide or deprotecting the N? of the N-terminal amino acid and reacting the free N? with a compound of formula IV R7-S—S—[CH2]2—COOH IV wherein R7 is aryl-, including heteronuclear aryl, or is aralkyl-, alkylaryl- or alkyl-, which may be further substituted with halogeno, amido, ester, carboxy or ether, and c. reacting the peptide with a S-tert.Butyl-sulphenyl-protection group removing reagent, and d.

Abstract: A novel method for side chain cyclisation of peptides by means of lactamization is provided.

Abstract: A novel method for on-resin formation of disulfide-borne cyclization of peptides is devised.

Abstract: An improved method for cyclization of peptide (H)-D-Phe-Cys-Tyr-D-Trp-Lys-Val-Cys-Trp(NH2) by cystine formation is devised.

Abstract: A biotechnological method is described for preparing compounds of the general formulas 1

Abstract: A biotechnological method is described for preparing compounds of the general formulas wherein R1 is acyl or acyloxy and R2 is a hydrogen atom or C1-10 alkyl, comprising the conversion of a lactam of the general formula by means of a hydrolase in the presence of a nucleophile and in the presence of a base in a constant pH range.

Abstract: A process including preparing a polyurethane in the presence of a catalyst which is a bicyclic amidine of the formula: wherein A is selected from the group consisting of —CR1R2—CR3R4—CR5R6—, —CR1R2—CR3R4—CR5R6—CR7R8—, and —CR1R2—CR3R4—CR5R6—CR7R8—CR9R10—, wherein the substituents in A are in each case numbered starting from the nitrogen atom, and B is selected from the group consisting of —CR11R12—CR13R14—, —CR11R12—CR15R16—CR13R14—, and —CR11R12—CR15R16—CR17R18—CR13R14—, and R1 to R18 are, in each case independent of one another, hydrogen, C1-C4-alkyl, aryl, or C1-C4-alkyl that is substituted with hydroxyl, amino, C1-C4-alkylamino or mercapto, with the proviso that at least one of the substituents R1 to R18 is (1) hydroxyl, (2) amino, (3) C1-C4-alkylamino, (4) mercapto, (5) C1-C4-alkyl substituted with hydroxyl, (6) C1-C4-alkyl sub

Abstract: A single-stage process is described for the preparation of primary aliphatic polyamines of the formula in which R1 and R2 independently of one another are hydrogen, methyl, ethyl or aminomethyl, by reaction of polyalcohols on a Co/Ni catalyst with supercritical ammonia in the presence of hydrogen.

Abstract: Microorganism which can utilize an N-protected proline derivative of general formula (I) in the form of the racemate or one of its optically active isomers, R1 meaning —(CH2)2—COOH or, optionally substituted in each case, C1-C4 alkoxy, aryl or aryloxy, and R2 meaning hydrogen or hydroxy, as the only nitrogen, only carbon or only carbon and nitrogen source. These microorganisms can be used in a process for producing N-protected cyclic or aliphatic D-amino acid derivatives of general formulae (II) and (V), A together with —N— and —CH— and R3, R4 and R5 having the given meanings.

Abstract: The process for the preparation of bicyclic amidines of the general formula: 1

Abstract: A novel method for synthesizing a Hirulog peptide is devised.