Patents by Inventor Oleg Werbitzky

Oleg Werbitzky has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 9040480
    Abstract: A new method of synthesizing GLP-1 peptide is devised.
    Type: Grant
    Filed: April 29, 2013
    Date of Patent: May 26, 2015
    Assignee: LONZA AG
    Inventors: Oleg Werbitzky, Stéphane Varray, Matthieu Giraud, Carsten Meininghaus
  • Patent number: 8445433
    Abstract: A new method of synthesizing GLP-1 peptide is devised.
    Type: Grant
    Filed: January 11, 2007
    Date of Patent: May 21, 2013
    Assignee: Lonza AG
    Inventors: Oleg Werbitzky, Stéphane Varray, Matthieu Giraud, Carsten Meininghaus
  • Patent number: 7994280
    Abstract: A novel compound of formula I is devised.
    Type: Grant
    Filed: October 18, 2005
    Date of Patent: August 9, 2011
    Assignee: Lonza AG
    Inventors: Stéphane Varray, Oleg Werbitzky, Thomas Zeiter
  • Patent number: 7939629
    Abstract: A novel method for synthesizing a Hirulog peptide is devised.
    Type: Grant
    Filed: October 19, 2005
    Date of Patent: May 10, 2011
    Assignee: Lonza AG
    Inventors: Anne-Sophie Droz, Jasmine Schnidrig, Nicole Studer, Stéphane Varray, Corinne Wenger, Oleg Werbitzky
  • Publication number: 20100249370
    Abstract: Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively.
    Type: Application
    Filed: June 30, 2008
    Publication date: September 30, 2010
    Applicant: LONZA AG
    Inventors: Andreas Brunner, Oleg Werbitzky, Stephane Varray, Francesca Quattrini, Holger Hermann, Andrew Strong, Fernando Albericio, Judit Tulla-Puche, Yesica Garcia Ramos
  • Publication number: 20100197891
    Abstract: A new method of anchoring a growing peptide chain during chemical synthesis to a solid-phase support is devised. Novel amino acid derivatives and peptide derivatives, both unbonded and bonded to a solid-phase support, are also provided.
    Type: Application
    Filed: October 3, 2007
    Publication date: August 5, 2010
    Inventors: Matthieu Giraud, Fernando Albericio, Francesca Quattrini, Oleg Werbitzky, Katja Senn, Michaela Williner
  • Publication number: 20090292106
    Abstract: A new method of synthesizing GLP-1 peptide is devised.
    Type: Application
    Filed: January 11, 2007
    Publication date: November 26, 2009
    Inventors: Oleg Werbitzky, Stéphane Varray, Matthieu Giraud, Carsten Meininghaus
  • Publication number: 20080287648
    Abstract: A novel method for synthesizing a Hirulog peptide is devised.
    Type: Application
    Filed: October 19, 2005
    Publication date: November 20, 2008
    Applicant: LONZA AG
    Inventors: Anne-Sophie Droz, Jasmine Schnidrig, Nicole Studer, Stephane Varray, Corrine Wenger, Oleg Werbitzky
  • Publication number: 20080200647
    Abstract: Method of peptide synthesis, comprising the steps of a. synthesizing a peptide linked to a solid phase which peptide comprises at least one cysteine, homo- or nor-cysteine residue, which cysteine is protected in its side chain by a S-tert.butyl-sulphenyl group b. either coupling N-terminally a further amino acid having a 3,3?-dithio-(1-carboxy-propyl)-propionyl-radical on its N? or deprotecting the N? of the N-terminal amino acid and reacting the free N? with 3,3?-dithio-propionic acid imide to yield the corresponding N?-3,3?-dithio-(1-carboxy-propyl)-propionamide or deprotecting the N? of the N-terminal amino acid and reacting the free N? with a compound of formula IV R7-S—S—[CH2]2—COOH IV wherein R7 is aryl-, including heteronuclear aryl, or is aralkyl-, alkylaryl- or alkyl-, which may be further substituted with halogeno, amido, ester, carboxy or ether, and c. reacting the peptide with a S-tert.Butyl-sulphenyl-protection group removing reagent, and d.
    Type: Application
    Filed: October 18, 2005
    Publication date: August 21, 2008
    Applicant: LONZA AG
    Inventors: Stephane Varray, Oleg Werbitzky, Thomas Zeiter
  • Publication number: 20080200648
    Abstract: A novel for amidation of C-terminal carboxyl groups of peptides is devised, which methods avoids undesired epimerisation of the ?-carbon of the C-terminal amino acid yielding diastereoisomeric variants of the amidated peptide.
    Type: Application
    Filed: July 13, 2005
    Publication date: August 21, 2008
    Applicant: LONZA AG
    Inventors: Matthieu Giraud, Michaela Williner, Oleg Werbitzky
  • Publication number: 20080171849
    Abstract: A novel method for side chain cyclisation of peptides by means of lactamization is provided.
    Type: Application
    Filed: September 20, 2005
    Publication date: July 17, 2008
    Inventors: Matthieu Giraud, Oleg Werbitzky, Michaela Williner
  • Publication number: 20080108790
    Abstract: A novel method for on-resin formation of disulfide-borne cyclization of peptides is devised.
    Type: Application
    Filed: October 26, 2005
    Publication date: May 8, 2008
    Applicant: LONZA AG
    Inventors: Stephane Varray, Oleg Werbitzky, Thomas Zeiter
  • Publication number: 20080097079
    Abstract: An improved method for cyclization of peptide (H)-D-Phe-Cys-Tyr-D-Trp-Lys-Val-Cys-Trp(NH2) by cystine formation is devised.
    Type: Application
    Filed: October 24, 2005
    Publication date: April 24, 2008
    Inventors: Francesca Quattrini, Stephane Varray, Oleg Werbitzky, Thomas Zeiter
  • Publication number: 20040167351
    Abstract: A biotechnological method is described for preparing compounds of the general formulas 1
    Type: Application
    Filed: February 13, 2004
    Publication date: August 26, 2004
    Inventors: Christine Bernegger-Egli, Frank Brux, Jean Paul Roduit, Oleg Werbitzky, Yves Guggisberg
  • Patent number: 6780634
    Abstract: A biotechnological method is described for preparing compounds of the general formulas wherein R1 is acyl or acyloxy and R2 is a hydrogen atom or C1-10 alkyl, comprising the conversion of a lactam of the general formula by means of a hydrolase in the presence of a nucleophile and in the presence of a base in a constant pH range.
    Type: Grant
    Filed: April 17, 2001
    Date of Patent: August 24, 2004
    Assignee: Lonza AG
    Inventors: Christine Bernegger-Egli, Frank Brux, Jean Paul Roduit, Oleg Werbitzky, Yves Guggisberg
  • Patent number: 6476175
    Abstract: A process including preparing a polyurethane in the presence of a catalyst which is a bicyclic amidine of the formula: wherein A is selected from the group consisting of —CR1R2—CR3R4—CR5R6—, —CR1R2—CR3R4—CR5R6—CR7R8—, and —CR1R2—CR3R4—CR5R6—CR7R8—CR9R10—, wherein the substituents in A are in each case numbered starting from the nitrogen atom, and B is selected from the group consisting of —CR11R12—CR13R14—, —CR11R12—CR15R16—CR13R14—, and —CR11R12—CR15R16—CR17R18—CR13R14—, and R1 to R18 are, in each case independent of one another, hydrogen, C1-C4-alkyl, aryl, or C1-C4-alkyl that is substituted with hydroxyl, amino, C1-C4-alkylamino or mercapto, with the proviso that at least one of the substituents R1 to R18 is (1) hydroxyl, (2) amino, (3) C1-C4-alkylamino, (4) mercapto, (5) C1-C4-alkyl substituted with hydroxyl, (6) C1-C4-alkyl sub
    Type: Grant
    Filed: May 24, 2001
    Date of Patent: November 5, 2002
    Assignee: Lonza Ltd.
    Inventors: Oleg Werbitzky, Ulrich Daum, Rachel Bregy
  • Patent number: 6376713
    Abstract: A single-stage process is described for the preparation of primary aliphatic polyamines of the formula in which R1 and R2 independently of one another are hydrogen, methyl, ethyl or aminomethyl, by reaction of polyalcohols on a Co/Ni catalyst with supercritical ammonia in the presence of hydrogen.
    Type: Grant
    Filed: September 27, 2000
    Date of Patent: April 23, 2002
    Assignee: Lonza AG
    Inventors: Alfons Baiker, Achim Fischer, Tamas Mallat, Oleg Werbitzky
  • Publication number: 20020028939
    Abstract: The process for the preparation of bicyclic amidines of the general formula: 1
    Type: Application
    Filed: May 24, 2001
    Publication date: March 7, 2002
    Inventors: Oleg Werbitzky, Ulrich Daum, Rachel Bregy
  • Patent number: 6255488
    Abstract: The process for the preparation of bicyclic amidines of the general formula: wherein A is selected from the group consisting of —CR1R2—CR3R4—CR5R6—, —CR1R2—CR3R4—CR5R6—CR7R8— and —CR1R2—CR3R4—CR5R6—CR7R8—CR9R10—, wherein the substituents in A are in each case numbered starting from the nitrogen atom, and B is selected from the group consisting of —CR11R12—CR13R14—, —CR11R12—CR15R16—CR13R4— and —CR11R12—CR15R16—CR17R18—CR13—R14—, and R1, R2 and R11 to R14 are, in each case independently of one another, hydrogen, C1-C4-alkyl, aryl, or are C1-C4-alkyl which is substituted with hydroxyl, amino, C1-C4-alkylamino or mercapto, and R3 to R10 and R15 to R18 are, in each case independently of one another, hydrogen, C1-C4-alkyl, aryl, hydroxyl, amino, C1-C4-alkylamino or mercapto, or are C1-C4-alkyl which is substituted with hydroxyl, am
    Type: Grant
    Filed: April 30, 1999
    Date of Patent: July 3, 2001
    Assignee: Lonza AG
    Inventors: Oleg Werbitzky, Ulrich Daum, Rachel Bregy
  • Patent number: RE46830
    Abstract: A novel method for synthesizing a Hirulog peptide is devised.
    Type: Grant
    Filed: March 17, 2015
    Date of Patent: May 8, 2018
    Assignee: Polypeptide Laboratories Holding (PPL) AB
    Inventors: Anne-Sophie Droz, Jasmine Schnidrig, Nicole Studer, Stéphane Varray, Corinne Wenger, Oleg Werbitzky