Patents by Inventor Peterus Leonardus-Josephus De Keizer

Peterus Leonardus-Josephus De Keizer has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 11723947
    Abstract: The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders.
    Type: Grant
    Filed: January 25, 2016
    Date of Patent: August 15, 2023
    Assignee: Erasmus University Medical Center Rotterdam
    Inventor: Peterus Leonardus Josephus de Keizer
  • Publication number: 20230090099
    Abstract: The present invention relates to improved compounds for use in the treatment of diseases or conditions where the removal of senescent cells, scarred cells, and/or cancerous cells is beneficial, for example cancer. The invention also relates to methods of treating an individual suffering, or suspected of suffering, from a disease or condition wherein the removal of senescent cells, scarred cells, and/or cancerous cells is beneficial.
    Type: Application
    Filed: February 22, 2021
    Publication date: March 23, 2023
    Inventors: Peterus Leonardus Josephus DE KEIZER, Michael TEIFEL, Tobias MADL, Benjamin Michel Rene BOURGEOIS, Emil SPREITZER, Yvonne Marie ANGELL, Marjolein Petronella BAAR
  • Publication number: 20180015137
    Abstract: The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders
    Type: Application
    Filed: January 25, 2016
    Publication date: January 18, 2018
    Inventor: Peterus Leonardus Josephus de Keizer
  • Publication number: 20130288980
    Abstract: The present invention relates to agents that inhibit FOXO4 function and uses thereof in treating cancer and/or removing senescent cells in an individual.
    Type: Application
    Filed: March 14, 2013
    Publication date: October 31, 2013
    Inventors: Peterus Leonardus-Josephus De Keizer, Judith Campisi, Remi-Martin Laberge
  • Publication number: 20130288981
    Abstract: The present invention relates to uses of agents that inhibit Jun kinases and/or FOXO4 in treating cancer and/or removing senescent cells in an individual.
    Type: Application
    Filed: March 14, 2013
    Publication date: October 31, 2013
    Inventors: Peterus Leonardus-Josephus de KEIZER, Judith Campisi, Remi-Martin Laberge