Patents by Inventor Peterus Leonardus-Josephus De Keizer

Peterus Leonardus-Josephus De Keizer has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20180015137
    Abstract: The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders
    Type: Application
    Filed: January 25, 2016
    Publication date: January 18, 2018
    Inventor: Peterus Leonardus Josephus de Keizer
  • Publication number: 20130288981
    Abstract: The present invention relates to uses of agents that inhibit Jun kinases and/or FOXO4 in treating cancer and/or removing senescent cells in an individual.
    Type: Application
    Filed: March 14, 2013
    Publication date: October 31, 2013
    Inventors: Peterus Leonardus-Josephus de KEIZER, Judith Campisi, Remi-Martin Laberge
  • Publication number: 20130288980
    Abstract: The present invention relates to agents that inhibit FOXO4 function and uses thereof in treating cancer and/or removing senescent cells in an individual.
    Type: Application
    Filed: March 14, 2013
    Publication date: October 31, 2013
    Inventors: Peterus Leonardus-Josephus De Keizer, Judith Campisi, Remi-Martin Laberge