Patents by Inventor Qishan Liang

Qishan Liang has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • ZINC FINGER PEPTIDES, PEPTIDE ARRAYS, AND METHODS OF USE THEREOF
    Publication number: 20250179129
    Abstract: Provided herein are zinc finger peptides comprising the amino acid sequence of SEQ ID NO: 1 (SDGDWICPDKKCGN-VNFARRTSCNRCGREKTT) and at least one substitution compared to SEQ ID NO: 1, wherein the zinc finger peptide is an engineered zinc finger peptide.
    Type: Application
    Filed: February 23, 2023
    Publication date: June 5, 2025
    Inventors: Kevin D. Corbett, Eugene Yeo, Qishan Liang
  • Use of phencynonate hydrochloride
    Publication number: 20040152722
    Abstract: This invention relates to the new use of Phencynonate Hydrochloride in pharmaceutical field, especially its use for treating or alleviating Parkinson's disease or Parkinson's syndrome.
    Type: Application
    Filed: March 26, 2004
    Publication date: August 5, 2004
    Inventors: Chuangui Liu, Qishan Liang, Zhanguo Gao, Wenyu Cui
  • Use of phencynonate hydrochloride
    Publication number: 20040097737
    Abstract: This invention relates to a new use of phencynonate hydrochloride, especially its use in the manufacture of medicament for treating or alleviating acute attack of vertigo.
    Type: Application
    Filed: January 6, 2004
    Publication date: May 20, 2004
    Inventors: Chuangui Liu, Qishan Liang, Zhanguo Gao, Wenyu Cui