Patents by Inventor Richard A. Wood
Richard A. Wood has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).
-
Patent number: 11435067Abstract: The invention relates to a lighting assembly (1), comprising an extendible mast (2) constructed and arranged so as to be configurable between a coiled form and an extended form, wherein when extended the mast is resiliently biased in the form of an elongate tube having a slit along its length and wherein when coiled the mast is wound about an axis extending transversely to the longitudinal extent of the mast; and, a lighting element (6) supported by the mast and extending along at least a portion of the mast.Type: GrantFiled: March 3, 2021Date of Patent: September 6, 2022Assignee: RTL MATERIALS LTD.Inventors: Richard Wood, Jean-Christophe Detis
-
Patent number: 11351267Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amiType: GrantFiled: June 15, 2020Date of Patent: June 7, 2022Assignee: Cilag GMBH InternationalInventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
-
Patent number: 11284971Abstract: A denture abutment retention apparatus and a denture including one or more denture abutment retention apparatuses configured to allow the denture to be easily engaged with and secured to a plurality of denture abutments in a user's mouth using sliding motion of the denture from the sides of the plurality of denture abutments.Type: GrantFiled: February 24, 2021Date of Patent: March 29, 2022Assignee: New Way Denture & Retention Systems, LLCInventors: Lawrence Richard Wood, Gregory Byron Evans, Anthony Leroy Henry
-
Publication number: 20210267728Abstract: A denture abutment retention apparatus and a denture including one or more denture abutment retention apparatuses configured to allow the denture to be easily engaged with and secured to a plurality of denture abutments in a user's mouth using sliding motion of the denture from the sides of the plurality of denture abutments.Type: ApplicationFiled: February 24, 2021Publication date: September 2, 2021Applicant: New Way Denture & Retention Systems, LLCInventors: Lawrence Richard Wood, Gregory Byron Evans, Anthony Leroy Henry
-
Publication number: 20210254453Abstract: Aspects of the present disclosure relate to a stand break detection system. In some embodiments, the stand break detection system includes a sensor and a data processing system. The sensor may measure a movement of drill pipe as it is tripped out of a wellbore. The processor may execute instructions stored in a memory to receive measured movement data from the sensor and identify a stand break associated with one or more drill pipes using the measured movement data.Type: ApplicationFiled: February 19, 2020Publication date: August 19, 2021Inventors: James Minh Tran, Richard Woods, Tania Maria Oviedo Gutierrez, Irina Kim
-
Publication number: 20210206558Abstract: A panel (14) for use in a thermally insulating container (2), the panel (14) comprising a body of a thermally insulating material in the form of a tray element (72) having one or more upwardly open compartments (74) for receiving thermal conditioning elements (16) therein.Type: ApplicationFiled: March 18, 2021Publication date: July 8, 2021Inventors: Sean Austerberry, Richard Wood, Kevin Valentine
-
Patent number: 10981714Abstract: A thermal conditioning wall panel 10 for use in a thermally insulating container comprises a panel body (22) having a channel (26) formed therein along one face thereof for receiving one or more thermal conditioning elements (12). At least one foot (32) is formed at the lower end of the body (22) for engagement within a socket provided on the thermally insulating container. The panel further comprises thermal conditioning element retaining elements (40) provided adjacent the longitudinal edges (29) of the channel (26), the retaining elements (40) projecting over a peripheral portion of the channel (26) for retaining the thermal conditioning elements (12) within the channel (26).Type: GrantFiled: December 5, 2019Date of Patent: April 20, 2021Assignee: PELI BIOTHERMAL LIMITEDInventors: Sean Austerberry, Richard Wood, Kevin Valentine
-
Patent number: 10958023Abstract: An electrical device having a bus side and a load side is provided. The electrical device includes a plurality of conductive line terminals disposed on the bus side of said electrical device, and a plurality of electrical connectors. Each electrical connector of the plurality of electrical connectors includes a first end coupled to a respective line terminal of the plurality of line terminals, a second end distal from the first end, and a connector clip disposed at the second end. Each connector clip is configured to engage a bus bar to electrically couple the electrical device to the bus bar, and includes a first contact segment and a second contact segment spaced apart from the first contact segment. The first and second contact segments are configured to deflect towards one another from a relaxed position to a depressed position when inserted into a connector channel defined by the bus bar.Type: GrantFiled: December 21, 2018Date of Patent: March 23, 2021Assignee: ABB SCHWEIZ AGInventors: Jeremy Robert Baillargeon, Michael Richard Wood, Mariusz Duda, Jason William Newby, Matthew Hock, Gregory Mathias Probert, John Matthew Hutson, Seth David Kravetz, Nicholas Hayes Ferruolo
-
Publication number: 20210009845Abstract: A coating composition for a food and/or beverage container comprising a polyester material, wherein the polyester material comprises the reaction product of; (a) 1,2-propanediol, (b) terephthalic acid, and (c) a molecular weight increasing agent, characterized in that the polyester material has a number-average molecular weight (Mn) of at least 6,100 Da and a glass transition temperature (Tg) of at least 80° C.Type: ApplicationFiled: July 28, 2020Publication date: January 14, 2021Inventors: Kam L. Lock, Richard Woods, Ibrahim Akseki, Beatrice Virginia Harrison
-
Publication number: 20200345859Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amiType: ApplicationFiled: June 15, 2020Publication date: November 5, 2020Applicant: Covagen AGInventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
-
Patent number: 10821218Abstract: Disclosed is a device for separating a cellular component from a multicomponent fluid. The device can comprise a body, a first acoustic wave generator, and a second acoustic wave propagating component. The body can define a channel having a first surface and a second surface opposite the first surface. The channel can extend along a longitudinal axis from a first end to a second end. The first acoustic wave generator can be coupled to the first surface. The first acoustic wave generator can be configured to generate an acoustic wave having a wavelength. The second acoustic wave propagating component can be coupled to the second surface. The second surface can be spaced an integer fractional multiple of the wavelength from the first surface and each integer factional multiple equals a number of pressure nodes within the channel.Type: GrantFiled: July 22, 2016Date of Patent: November 3, 2020Assignee: Biomet Biologics, LLCInventors: Randel E. Dorian, Richard Wood Storrs, Michael D. Leach, Ned M. Hamman, Joel Carne
-
Publication number: 20200255074Abstract: A paving machine for spreading, leveling and finishing concrete having a main frame, center module, bolsters laterally movably, and a crawler track associated with respective aft and forward ends of the bolsters. A bolster swing leg for each crawler track supports an upright jacking column. A worm gear drive permits rotational movements of the crawler track and the jacking column. A hinge bracket is interposed between each swing leg and a surface of the bolsters to enable pivotal movements of the swing leg. A length-adjustable holder engages the pivot pin on the hinge bracket and pivotally engages the swing leg. The holder permits pivotal motions of the swing leg in its length-adjustable configuration and prevents substantially any motion of the swing leg in its fixed-length configuration. A feedback loop cooperates with transducers keeping the crawler tracks position. The paving machine can be reconfigured into a narrowed transport configuration.Type: ApplicationFiled: March 16, 2020Publication date: August 13, 2020Applicant: GUNTERT & ZIMMERMAN CONST. DIV., INC.Inventors: Ronald M. Guntert, JR., Gerald L. Dahlinger, Richard Wood Francis
-
Patent number: 10737012Abstract: Disclosed is a device for separating a cellular component from a multicomponent fluid. The device can include a body, a first acoustic wave generator, and a second acoustic wave propagating component. The body can define a channel having a first surface, an opposing second surface, a first side, and an opposing second side. The channel can extend along a longitudinal axis from a first end to an opposing second end. The first acoustic wave generator can be coupled to the first surface. The second acoustic wave propagating component can be coupled to the second surface. The first acoustic wave generator and second acoustic wave propagating component can be configured to generate a bulk standing acoustic wave in the channel.Type: GrantFiled: July 22, 2016Date of Patent: August 11, 2020Assignee: Biomet Biologics, Inc.Inventors: Michael D. Leach, Ned M. Hamman, David Abeskaron, Grant Cunningham, Randel Dorian, Richard Wood Storrs, Scott R. King
-
Patent number: 10722589Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amiType: GrantFiled: April 2, 2018Date of Patent: July 28, 2020Assignee: Covagen AGInventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
-
Publication number: 20200188134Abstract: A bone part is repaired by a process. A first implant is attached to a first bone part. The first implant corresponds to an intraoperatively defined or an intraoperatively selected cutting path. A preoperatively defined second implant is attached to the first implant. The first implant and the second implant together augment the first bone part.Type: ApplicationFiled: December 13, 2019Publication date: June 18, 2020Inventors: Lewis Mullen, Robert Carter, Marc Esformes, Chau Ngo, Richard Wood
-
Publication number: 20200108997Abstract: A thermal conditioning wall panel 10 for use in a thermally insulating container comprises a panel body (22) having a channel (26) formed therein along one face thereof for receiving one or more thermal conditioning elements (12). At least one foot (32) is formed at the lower end of the body (22) for engagement within a socket provided on the thermally insulating container. The panel further comprises thermal conditioning element retaining elements (40) provided adjacent the longitudinal edges (29) of the channel (26), the retaining elements (40) projecting over a peripheral portion of the channel (26) for retaining the thermal conditioning elements (12) within the channel (26).Type: ApplicationFiled: December 5, 2019Publication date: April 9, 2020Inventors: Sean Austerberry, Richard Wood, Kevin Valentine
-
Patent number: 10589807Abstract: A paving machine for spreading, leveling and finishing concrete having a main frame, center module, bolsters laterally movably, and a crawler track associated with respective aft and forward ends of the bolsters. A bolster swing leg for each crawler track supports an upright jacking column. A worm gear drive permits rotational movements of the crawler track and the jacking column. A hinge bracket is interposed between each swing leg and a surface of the bolsters to enable pivotal movements of the swing leg. A length-adjustable holder engages the pivot pin on the hinge bracket and pivotally engages the swing leg. The holder permits pivotal motions of the swing leg in its length-adjustable configuration and prevents substantially any motion of the swing leg in its fixed-length configuration. A feedback loop cooperates with transducers keeping the crawler tracks position. The paving machine can be reconfigured into a narrowed transport configuration.Type: GrantFiled: December 17, 2018Date of Patent: March 17, 2020Assignee: Guntert & Zimmerman Const. Div., Inc.Inventors: Ronald M. Guntert, Jr., Gerald L. Dahlinger, Richard Wood Francis
-
Patent number: 10562694Abstract: A thermal conditioning wall panel (10) for use in a thermally insulating container comprises a panel body (22) having a channel (26) formed therein along one face thereof for receiving one or more thermal conditioning elements (12). At least one foot (32) is formed at the lower end of the body (22) for engagement within a socket provided on the thermally insulating container. The panel further comprises thermal conditioning element retaining elements (40) provided adjacent the longitudinal edges (29) of the channel (26), the retaining elements (40) projecting over a peripheral portion of the channel (26) for retaining the thermal conditioning elements (12) within the channel (26).Type: GrantFiled: September 11, 2015Date of Patent: February 18, 2020Assignee: Peli Biothermal LimitedInventors: Sean Austerberry, Richard Wood, Kevin Valentine
-
Patent number: 10538365Abstract: The present disclosure generally relates to an insulating device, for example a cooler, and a latch and latching system for securing a lid of the insulating device in a closed position. More specifically, the insulating device includes a chest coupled to a lid, and a ledge extending from the chest. A slot is formed in the ledge and for each slot, a pair of protrusions extend from a bottom surface of the ledge on other side of the slot. The protrusions are received by corresponding recesses formed in the latch. Thus, when the latch is in the engaged position, the protrusions are physically securely engaged in the recesses by virtue of the latch being in a tensioned configuration.Type: GrantFiled: January 16, 2018Date of Patent: January 21, 2020Assignee: CASCADE MOUNTAIN TECHNOLOGIES, LLCInventor: Richard Wood
-
Publication number: 20200011083Abstract: A connector element for a tubular mast assembly, a tubular mast assembly and a kit therefore, methods of assembling and disassembling, a guide device and a spreader are provided. In an aspect, a tubular mast assembly comprises first and second members each comprising a shell resiliently biased in the form of an elongate tube having longitudinal edges defining a slit along its length. A connector element comprising a first socket receives an end of the first member and a second socket receives an end of the second member so as to connect the first and second members into an extended tubular form. Each member can be disconnected from its socket and its shell opened out at the slit to assume a flattened form in which it can be wound into a coiled form for stowing the assembly.Type: ApplicationFiled: September 19, 2019Publication date: January 9, 2020Inventors: Andrew Daton-Lovett, Richard Wood