Abstract: Systems and methods include a medical device that scans for wireless broadcasts based upon received input or satisfying a scanning criterion. The medical device, based upon the scan, identifies data wirelessly broadcast from a control device. The medical device outputs information to the interface identifying the control device. The medical device receives input from the interface selecting the control device. The medical device receives a command from the control device. The medical device physically interacts with a user based upon the command received from the control device. The medical device sends wireless confirmation of pairing to the control device. The medical device subsequently sends wireless confirmation of unpairing to the control device. The medical device performs a scan for wireless broadcasts in response to the unpairing, based upon received input or satisfying the scanning criterion.

Abstract: An exemplary line holder comprises a sheet having creases that extend between opposing sides and define a plurality of panels. The creases are foldable in alternating opposite directions such that the sheet is foldable along the creases between an open configuration and a pleated configuration. The line holder further comprises aligned groups of holes that are arranged along a direction substantially transverse to the creases, with each aligned group of holes comprising one hole in each of the panels. The line holder further comprises slots, each connecting a pair of the holes and intersecting one of the creases. When the sheet is in the pleated configuration, each aligned group of holes forms a corridor through the panels, and the slots are aligned to form pathways extending from the intersected creases to the corridors, such that medical lines can be inserted into the corridors.

Abstract: An exemplary line holder comprises a sheet having creases that extend between opposing sides and define a plurality of panels. The creases are foldable in alternating opposite directions such that the sheet is foldable along the creases between an open configuration and a pleated configuration. The line holder further comprises aligned groups of holes that are arranged along a direction substantially transverse to the creases, with each aligned group of holes comprising one hole in each of the panels. The line holder further comprises slots, each connecting a pair of the holes and intersecting one of the creases. When the sheet is in the pleated configuration, each aligned group of holes forms a corridor through the panels, and the slots are aligned to form pathways extending from the intersected creases to the corridors, such that medical lines can be inserted into the corridors.

Abstract: A system that monitors various conditions of a plurality of hospital beds located in different rooms of a healthcare facility is provided. Alternatively or additionally, other types of equipment may be monitored by the system. Various configurations of network interface units that are coupleable to or integrated into a hospital bed are also disclosed. The system receives data from the hospital beds and/or other equipment and initiates a communication to a wireless communication device of at least one designated caregiver in response to the received data being indicative of an alarm condition.

Abstract: A hospital bed, patient/nurse call system, and a hospital network are provided. Communication is provided over a packet based communication network.

Abstract: The present invention encompasses monoclonal antibodies that bind to lipoteichoic acid (LTA) of Gram positive bacteria. The antibodies also bind to whole bacteria and enhance phagocytosis and killing of the bacteria in vitro. The invention also provides antibodies having human sequences (chimeric, humanized and human antibodies). The invention also sets forth the variable regions of three antibodies within the invention and presents the striking homology between them.

Abstract: The present invention encompasses protective monoclonal antibodies that bind to peptidoglycan of Gram-positive bacteria. The antibodies also bind to whole bacteria and enhance phagocytosis and killing of the bacteria in vitro and block nasal colonization by Gram-positive bacteria in vivo. The invention also provides human, humanized and chimeric antibodies. The invention also sets forth the heavy chain and light chain variable regions of an antibody within the invention.

Abstract: An activity based monitoring system is disclosed, the activity based monitoring system being configured to monitor a plurality of badges associated with a plurality of assets within a healthcare facility.

Abstract: A hospital bed has wireless communication circuitry operable to transmit wirelessly bed status data. A surface supported by the bed has wireless communication circuitry operable to transmit wirelessly surface status data. The wireless communication circuitry of the hospital bed and the wireless communication circuitry of the surface communicate with a network independently. A hospital bed with an integrated surface has wireless communication circuitry operable to transmit wirelessly bed status data and surface status data. The wireless bed status data and the wireless surface status data are received by wireless access points of a network of a healthcare facility.

Abstract: A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO. 2) and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

Abstract: A hospital bed, patient/nurse call system, and a hospital network are provided. Communication is provided over a packet based communication network.

Abstract: A system that monitors various conditions of a plurality of hospital beds located in different rooms of a healthcare facility is provided. Alternatively or additionally, other types of equipment may be monitored by the system. Various configurations of network interface units that are coupleable to or integrated into a hospital bed are also disclosed. The system receives data from the hospital beds and/or other equipment and initiates a communication to a wireless communication device of at least one designated caregiver in response to the received data being indicative of an alarm condition.

Abstract: The present invention encompasses monoclonal and chimeric antibodies that bind to lipoteichoic acid of Gram positive bacteria. The antibodies also bind to whole bacteria and enhance phagocytosis and killing of the bacteria in vitro and enhance protection from lethal infection in vivo. The mouse monoclonal antibody has been humanized and the resulting chimeric antibody provides a previously unknown means to diagnose, prevent and/or treat infections caused by gram positive bacteria bearing lipoteichoic acid. This invention also encompasses a peptide mimic of the lipoteichoic acid epitope binding site defined by the monoclonal antibody. This epitope or epitope peptide mimic identifies other antibodies that may bind to the lipoteichoic acid epitope. Moreover, the epitope or epitope peptide mimic provides a valuable substrate for the generation of vaccines or other therapeutics.

Abstract: A hospital monitoring system for monitoring hospital personnel, a plurality of patient locations for patients, and associated devices is configured to control the associated devices based on the presence of hospital personnel or alarms.

Abstract: A monoclonal antibody to a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA. The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

Abstract: An activity based monitoring system is disclosed, the activity based monitoring system being configured to monitor a plurality of badges associated with a plurality of assets within a healthcare facility.