Patents by Inventor Richard Woods

Richard Woods has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 11970992
    Abstract: An acoustic core may include an array of resonant cells configured as a plurality of resonant cell groups. The resonant cell groups may include a plurality of resonant cells configured as a partitioned resonant cell that include a converging resonant cell and a diverging resonant cell. The converging resonant cell and the diverging resonant cell may be defined by a plurality of cell walls integrally formed with one another and a partition integrally formed with the plurality of cell walls. The partition may at least partially delimit the converging resonant cell from the diverging resonant cell. The converging resonant cell may define an upper resonant space delimited by the partition and a top face of the array of resonant cells. The diverging resonant cell may define a lower resonant space delimited by the partition and a bottom face of the array of resonant cells.
    Type: Grant
    Filed: June 3, 2021
    Date of Patent: April 30, 2024
    Assignee: General Electric Company
    Inventors: Wendy Wenling Lin, David Herman, Trevor Howard Wood, Nikolai N. Pastouchenko, Kishore Ramakrishnan, Timothy Richard DePuy, Robert William Davidoff
  • Patent number: 11958102
    Abstract: A method of repairing a chain can include aligning a bore of an outer chain link with a bore of an inner chain link, inserting a pin through the aligned bores, the pin having a thread end opposite a head end, engaging a multi-jackbolt tensioner with the thread end of the pin, the multi-jackbolt tensioner having a plurality of fasteners, advancing each of the plurality of fasteners to press on the outer chain link, and forming an interference fit between the pin and the outer chain link at the bore of the outer chain link from the advancing of the fasteners.
    Type: Grant
    Filed: May 14, 2021
    Date of Patent: April 16, 2024
    Assignee: REXNORD INDUSTRIES, LLC
    Inventors: Joseph Leo Vento, David Richard Woods, Kyle Steven Jansson
  • Publication number: 20240109176
    Abstract: The application describes a tool comprising a tool head and a handle. An end of the handle is connectable to the tool head. The handle comprises a bistable reelable composite member having a first stable form in the form of an elongate slit tube in which form the member is resiliently biased and acts as a handle when connected to the tool head. When separated from the tool head, the tube can be opened out at the slit at an end and progressively coiled around an axis transverse to its length to reversibly attain a second stable form in the form of a coil. Thus, the tool can assume a compact form for storage or transportation.
    Type: Application
    Filed: December 31, 2021
    Publication date: April 4, 2024
    Inventor: Richard Wood
  • Patent number: 11943191
    Abstract: Techniques for live location sharing are described. A first mobile device and a second mobile device can communicate with one another using an IM program. The first mobile device can receive a user input to share a location of the first mobile device in the IM program. Sharing the location can include causing the second mobile device to display a location of the first mobile device in an IM program user interface on the second mobile device. Duration of sharing the location can be user-configurable. The second mobile device may or may not share a location of the second device for display in the IM program executing on the first mobile device.
    Type: Grant
    Filed: August 5, 2019
    Date of Patent: March 26, 2024
    Assignee: Apple Inc.
    Inventors: Roberto Garcia, Eugene M. Bistolas, Justin Wood, Lawrence Yuan Yang, Scott Lopatin, Richard R. Dellinger
  • Publication number: 20240083042
    Abstract: The present invention relates to a device for gripping a flat structure with openings in the area of its upper side, in particular a honeycomb structure, comprising two gripper units spaced apart from each other in a length direction, each of which in turn comprises at least one pin, and at least one pin displacement unit which is adapted to displace the at least one pin in an extending direction, as well as a tilting unit which is adapted to tilt at least one of the gripper units about a tilting axis extending substantially in a width direction. The invention also relates to a method for gripping a flat structure by means of such a device.
    Type: Application
    Filed: September 12, 2023
    Publication date: March 14, 2024
    Applicant: Cevotec GmbH
    Inventors: David Woods, Richard Carle, Florian Lenz
  • Publication number: 20230399064
    Abstract: A paving machine for spreading, leveling and finishing concrete having a main frame, center module, bolsters laterally movably, and a crawler track associated with respective aft and forward ends of the bolsters. A bolster swing leg for each crawler track supports an upright jacking column. A worm gear drive permits rotational movements of the crawler track and the jacking column. A hinge bracket is interposed between each swing leg and a surface of the bolsters to enable pivotal movements of the swing leg. A length-adjustable holder engages the pivot pin on the hinge bracket and pivotally engages the swing leg. The holder permits pivotal motions of the swing leg in its length-adjustable configuration and prevents substantially any motion of the swing leg in its fixed-length configuration. A feedback loop cooperates with transducers keeping the crawler tracks position. The paving machine can be reconfigured into a narrowed transport configuration.
    Type: Application
    Filed: August 24, 2023
    Publication date: December 14, 2023
    Applicant: GUNTERT & ZIMMERMAN CONST. DIV., INC.
    Inventors: Ronald M. Guntert, JR., Gerald L. Dahlinger, Richard Wood Francis
  • Patent number: 11772723
    Abstract: A paving machine including a modular frame, a plurality of swing legs pivotable relative to the frame, a jacking column secured to each swing leg, a crawler track, a slew gear drive, and angular position transducers for measuring an angular position between the swing leg and the modular frame, and an angular position of the crawler track relative to the jacking column. Feedback from the transducers facilitates maintaining position of the crawler track. The jacking column can include telescoping outer and inner tubes, a vertically oriented hydraulic actuator including a cylinder and a piston operable within the outer and inner tubes, and spaced apart axial bearings coupled to the outer tube and/or the inner tube. The slew gear drive can be secured between the inner tube and a yoke and capable of steering the crawler track under load without lifting the crawler track.
    Type: Grant
    Filed: August 9, 2022
    Date of Patent: October 3, 2023
    Assignee: GUNTERT & ZIMMERMAN CONST. DIV., INC.
    Inventors: Ronald M. Guntert, Jr., Gerald L. Dahlinger, Richard Wood Francis
  • Publication number: 20230296001
    Abstract: In conventional wireline intervention shifting service, the success of the operation is heavily dependent on the engineer’s experience and knowledge. Any wrong judgement in the process of operation could lead to non-productive time or even total failure. Once the operation is completed, the post-job processing and report preparation also require significant manual effort and are extremely time consuming, which often leads to the inadequate or incomplete report. These challenges are addressed by the advanced surface acquisition software presented in this paper. The aim of the surface software is to redefine the selective shifting workflow by leveraging the available instrumentation, streamlining and simplifying operation procedures, eliminating or reducing the typical human errors observed earlier, and greatly reducing the burden on the field engineers for post-job deliverables with automated real-time data collection, processing, and report generation.
    Type: Application
    Filed: October 10, 2022
    Publication date: September 21, 2023
    Inventors: Jisheng Li, Yang Hu, Thomas Mauchien, Benjamin Jean Yvon Durand, Xuedong Yang, Richard Woods, Tzy Yu Chow, Amanda Olivio
  • Publication number: 20230183157
    Abstract: The present disclosure relates to the preparation of halogenated dihydroxybenzene compounds with high yield, selectivity and purity. The compounds are useful, among other things, in the synthesis of cannabinoids and cannabinoid-type compounds.
    Type: Application
    Filed: May 29, 2020
    Publication date: June 15, 2023
    Inventors: Daniel M. HALLOW, Mark C. DOBISH, Gnel MKRTCHYAN, Richard WOOD, Ramanaiah C. KANAMARLAPUDI, Achintya SUJAN, Amber BURCH
  • Patent number: 11634651
    Abstract: Embodiments of the invention improve the performance, safety, and efficiency of the gasification process. Embodiments of the invention improve downdraft gasification by improving upon the systems and methods for fuel preparation and by addressing gasifier bridging and channeling. Unique parts of the system include a unique hearth and grate design, a programmable logic controller and interface for managing the gasification process, an improved filtration system, a unique system for eliminating mist, a unique system for cooling gas, a unique combined flare, an integrated auger system, and a new system and method for sampling gas.
    Type: Grant
    Filed: September 8, 2017
    Date of Patent: April 25, 2023
    Assignee: Waste to Energy Systems, LLC
    Inventors: Richard Woods, Frank Larmon, Alejandro Martinez, Alissa Woods Mahoney, David McBurnett
  • Publication number: 20230074450
    Abstract: A paving machine for spreading, leveling and finishing concrete having a main frame, center module, bolsters laterally movably, and a crawler track associated with respective aft and forward ends of the bolsters. A bolster swing leg for each crawler track supports an upright jacking column. A worm gear drive permits rotational movements of the crawler track and the jacking column. A hinge bracket is interposed between each swing leg and a surface of the bolsters to enable pivotal movements of the swing leg. A length-adjustable holder engages the pivot pin on the hinge bracket and pivotally engages the swing leg. The holder permits pivotal motions of the swing leg in its length-adjustable configuration and prevents substantially any motion of the swing leg in its fixed-length configuration. A feedback loop cooperates with transducers keeping the crawler tracks position. The paving machine can be reconfigured into a narrowed transport configuration.
    Type: Application
    Filed: August 9, 2022
    Publication date: March 9, 2023
    Applicant: GUNTERT & ZIMMERMAN CONST. DIV., INC.
    Inventors: Ronald M. Guntert, JR., Gerald L. Dahlinger, Richard Wood Francis
  • Patent number: 11535318
    Abstract: A swing leg assembly, coupled to a paving machine for spreading, leveling and finishing concrete, includes a pivotable swing leg coupled to the paving machine. The swing leg may pivot between multiple angular orientations relative to the paving machine. A jacking column is coupled to the swing leg, and a crawler track is coupled to the jacking column. A slew drive coupled to the jacking column and crawler track rotates the crawler track relative to the jacking column between multiple angular orientations. A processor using sensors determines the angular positions of the swing leg and crawler track, and in response to determining a change in angular orientation of the swing leg controls the slew drive to cause the crawler track to rotate relative to the jacking column.
    Type: Grant
    Filed: March 16, 2020
    Date of Patent: December 27, 2022
    Assignee: Guntert & Zimmerman Const. Div., Inc.
    Inventors: Ronald M. Guntert, Jr., Gerald L. Dahlinger, Richard Wood Francis
  • Patent number: 11530608
    Abstract: Aspects of the present disclosure relate to a stand break detection system. In some embodiments, the stand break detection system includes a sensor and a data processing system. The sensor may measure a movement of drill pipe as it is tripped out of a wellbore. The processor may execute instructions stored in a memory to receive measured movement data from the sensor and identify a stand break associated with one or more drill pipes using the measured movement data.
    Type: Grant
    Filed: February 19, 2020
    Date of Patent: December 20, 2022
    Assignee: SCHLUMBERGER TECHNOLOGY CORPORATION
    Inventors: James Minh Tran, Richard Woods, Tania Maria Oviedo Gutierrez, Irina Kim
  • Publication number: 20220397234
    Abstract: The present invention relates to a collapsible stand, a kit for a collapsible stand and to associated methods and apparatus. The collapsible stand is intended for supporting an object, and includes a head unit comprising a fixture for attaching to the object, and one or more leg sockets; and one or more legs proximal ends of which are reversibly received in the respective leg sockets. Each leg comprises a bistable reelable composite member having a first stable form in the form of an elongate slit tube in which form the member is resiliently biased and acts as a leg. When removed from the socket, the tube can be opened out at the slit at an end and progressively coiled to reversibly attain a second stable form in the form of a coil. The coil defines an internal space for accommodating at least part of the head unit.
    Type: Application
    Filed: October 22, 2020
    Publication date: December 15, 2022
    Inventor: Richard Wood
  • Publication number: 20220387146
    Abstract: A denture abutment retention apparatus and a denture including one or more denture abutment retention apparatuses configured to allow the denture to be easily engaged with and secured to a plurality of denture abutments in a user's mouth using sliding motion of the denture from the sides of the plurality of denture abutments.
    Type: Application
    Filed: March 4, 2022
    Publication date: December 8, 2022
    Applicant: New Way Denture & Retention Systems, LLC
    Inventors: Lawrence Richard Wood, Gregory Byron Evans, Anthony Leroy Henry
  • Publication number: 20220362835
    Abstract: A method of repairing a chain can include aligning a bore of an outer chain link with a bore of an inner chain link, inserting a pin through the aligned bores, the pin having a thread end opposite a head end, engaging a multi-jackbolt tensioner with the thread end of the pin, the multi-jackbolt tensioner having a plurality of fasteners, advancing each of the plurality of fasteners to press on the outer chain link, and forming an interference fit between the pin and the outer chain link at the bore of the outer chain link from the advancing of the fasteners.
    Type: Application
    Filed: May 14, 2021
    Publication date: November 17, 2022
    Inventors: Joseph Leo Vento, David Richard Woods, Kyle Steven Jansson
  • Publication number: 20220282857
    Abstract: The invention relates to a lighting assembly (1), comprising an extendible mast (2) constructed and arranged so as to be configurable between a coiled form and an extended form, wherein when extended the mast is resiliently biased in the form of an elongate tube having a slit along its length and wherein when coiled the mast is wound about an axis extending transversely to the longitudinal extent of the mast; and, a lighting element (6) supported by the mast and extending along at least a portion of the mast.
    Type: Application
    Filed: March 3, 2021
    Publication date: September 8, 2022
    Inventors: Richard WOOD, Jean-Christophe DETIS
  • Patent number: 11435067
    Abstract: The invention relates to a lighting assembly (1), comprising an extendible mast (2) constructed and arranged so as to be configurable between a coiled form and an extended form, wherein when extended the mast is resiliently biased in the form of an elongate tube having a slit along its length and wherein when coiled the mast is wound about an axis extending transversely to the longitudinal extent of the mast; and, a lighting element (6) supported by the mast and extending along at least a portion of the mast.
    Type: Grant
    Filed: March 3, 2021
    Date of Patent: September 6, 2022
    Assignee: RTL MATERIALS LTD.
    Inventors: Richard Wood, Jean-Christophe Detis
  • Patent number: 11351267
    Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami
    Type: Grant
    Filed: June 15, 2020
    Date of Patent: June 7, 2022
    Assignee: Cilag GMBH International
    Inventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
  • Patent number: 11284971
    Abstract: A denture abutment retention apparatus and a denture including one or more denture abutment retention apparatuses configured to allow the denture to be easily engaged with and secured to a plurality of denture abutments in a user's mouth using sliding motion of the denture from the sides of the plurality of denture abutments.
    Type: Grant
    Filed: February 24, 2021
    Date of Patent: March 29, 2022
    Assignee: New Way Denture & Retention Systems, LLC
    Inventors: Lawrence Richard Wood, Gregory Byron Evans, Anthony Leroy Henry