Abstract: A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Abstract: A polypeptide having an amino acid sequence in which the number of RGD sequences contained per molecular weight of 10 kDa is not less than 0.30; the number of GFPGER sequences contained per molecular weight of 10 kDa is not less than 0.15; and the number of GVMGFP sequences contained per molecular weight of 10 kDa is less than 0.30; is provided. A scaffold composition, a composition for repairing a cartilage tissue, a composition for culturing cartilage cells, and a composition for promoting glycosaminoglycan production, which compositions contain the above polypeptide, are also provided.

Abstract: A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Abstract: A polypeptide having an amino acid sequence in which the number of RGD sequences contained per molecular weight of 10 kDa is not less than 0.30; the number of GFPGER sequences contained per molecular weight of 10 kDa is not less than 0.15; and the number of GVMGFP sequences contained per molecular weight of 10 kDa is less than 0.30; is provided. A scaffold composition, a composition for repairing a cartilage tissue, a composition for culturing cartilage cells, and a composition for promoting glycosaminoglycan production, which compositions contain the above polypeptide, are also provided.

Abstract: A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Abstract: A method for selectively separating and purifying RNA from a mixture solution of nucleic acid containing DNA and RNA, wherein the method comprising the steps of: (1-a) adsorbing nucleic acid; (1-b) washing; (1-c) subjecting to a DNase treatment; (1-d) washing; and (1-e) desorbing the RNA from a nucleic acid-adsorbing porous membrane by a recovering solution, wherein in the step (1-c), a total amount of a DNase solution is 130 ?l or less per 1 cm2 of the membrane. And a method for selectively separating and purifying RNA or DNA, which comprises the steps of: (2-a) adsorbing nucleic acid; (2-b) washing by a washing solution; and (2-c) desorbing the nucleic acid from a nucleic acid-adsorbing porous membrane, wherein the washing solution contains a water-soluble organic solvent having a concentration of 50% by weight or less, and does not contain a chaotropic salt.

Abstract: A method for selectively separating and purifying RNA from a mixture solution of nucleic acid containing DNA and RNA, wherein the method comprising the steps of: (1-a) adsorbing nucleic acid; (1-b) washing; (1-c) subjecting to a DNase treatment; (1-d) washing; and (1-e) desorbing the RNA from a nucleic acid-adsorbing porous membrane by a recovering solution, wherein in the step (1-c), a total amount of a DNase solution is 130 ?l or less per 1 cm2 of the membrane. And a method for selectively separating and purifying RNA or DNA, which comprises the steps of: (2-a) adsorbing nucleic acid; (2-b) washing by a washing solution; and (2-c) desorbing the nucleic acid from a nucleic acid-adsorbing porous membrane, wherein the washing solution contains a water-soluble organic solvent having a concentration of 50% by weight or less, and does not contain a chaotropic salt.

Abstract: A method for separating and purifying a nucleic acid comprising steps of: (1) adding a lysis solution to a biomaterial to prepare a sample solution containing a nucleic acid, and adding a water-soluble organic solvent or a solution containing a water-soluble organic solvent to the sample solution thereby preparing a sample solution containing the water-soluble organic solvent; (2) contacting the sample solution containing the water-soluble organic solvent with a solid phase thereby adsorbing the nucleic acid on the solid phase; (3) contacting a washing solution with the solid phase thereby washing the solid phase in a state where the nucleic acid is adsorbed on the solid phase; and (4) contacting a recovering solution with the solid phase thereby desorbing the nucleic acid from the solid phase, wherein, in the step (1), the water-soluble organic solvent or the solution containing the water-soluble organic solvent is added separately in at least two batches.

Abstract: A method for separating and purifying a nucleic acid, which comprises: (1) adsorbing the nucleic acid to a nucleic acid adsorbing porous membrane by passing a sample solution containing the nucleic acid through the nucleic acid adsorbing porous membrane; (2) washing the nucleic acid adsorbing porous membrane by passing a washing solution through the nucleic acid adsorbing porous membrane, while the nucleic acid is adsorbed to the nucleic acid adsorbing porous membrane; and (3) desorbing the nucleic acid from the nucleic acid adsorbing porous membrane by passing a recovering solution through the nucleic acid adsorbing porous membrane, wherein the nucleic acid adsorbing porous membrane is a porous membrane that has a contact angle of 60 degree or less after 17 m seconds of contact of the porous membrane with 3 ?l of water dropped to the porous membrane.