Patents by Inventor Robert Bals

Robert Bals has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Modulating angiogenesis using LL-37/HCAP-18
    Publication number: 20060275303
    Abstract: A pharmaceutical composition containing a peptide or pharmaceutically acceptable salt thereof containing the amino acid sequence [LL-37, 37 aa] (LL-37); for preventing or treating wounds, tumors, or disease caused by or resulting in a reduced level of angiogenesis or of arteriogenesis is disclosed.
    Type: Application
    Filed: February 26, 2004
    Publication date: December 7, 2006
    Inventors: Robert Bals, Andreas Koczulla, Georg Degenfeld-Schonburg
  • Compositions and methods for use of defensin
    Patent number: 6399370
    Abstract: The invention relates to mammalian beta defensin and methods of use thereof for treatment of microbial infection.
    Type: Grant
    Filed: January 12, 1999
    Date of Patent: June 4, 2002
    Assignees: The Trustees of the University of Pennsylvania, Magainin Pharmaceuticals, Inc.
    Inventors: James M. Wilson, Mitchell Goldman, Robert Bals, Ethan D. Stolzenberg, Mark Anderson, Michael Zasloff, Prasad Kari