Patents by Inventor Robert Fine

Robert Fine has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20070173443
    Abstract: Disclosed are polypeptides comprising a first segment of continuous amino acids having the sequence AQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD (SEQ ID NO. 1) covalently linked to a second segment of continuous amino acids having the sequence DSDPGETKFMLKKHRSTSQGKKSKLHSSHARSGGPEKGAQA (SEQ ID NO. 2), or at least two of each covalently linked to each ether. The polypeptides are shown to induce apoptosis of cancer cells that contain mutant p53 or over-expressed wild-type p53.
    Type: Application
    Filed: January 27, 2005
    Publication date: July 26, 2007
    Inventors: Robert Fine, Paul Brandt-Rauf, Yueha Mao
  • Publication number: 20070050257
    Abstract: The present invention is an online publishing management system and method that includes at least one advertisement computer means for storing an advertisement file; at least one article computer means for storing an article file; and a publishing management server computer. The publishing management server computer includes user interface means for receiving data from and sending data to user, database means for storing a plurality of database tables, and processing means.
    Type: Application
    Filed: June 8, 2006
    Publication date: March 1, 2007
    Applicant: SELLING COMMUNICATIONS, INC.
    Inventors: Robert Fine, Bruce Bolger, James Kilmetis