Patents by Inventor Stefan Niewiarowski

Stefan Niewiarowski has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • EC-3, an inhibitor of &agr;4&bgr;1 and &agr;4&bgr;7 integrins
    Patent number: 6818617
    Abstract: This invention relates to the identification, purification, and characterization of a novel heterodimeric disintegrin, EC-3, from Echis carinatus viper venom. EC-3 inhibits &agr;4 integrins in an RGD-independent manner. The invention further relates to methods of using EC-3, or a biologically active fragment or derivative thereof, to inhibit the interaction between cells expressing &agr;4 integrins and cellular ligands.
    Type: Grant
    Filed: February 7, 2000
    Date of Patent: November 16, 2004
    Assignee: Temple University- Of The Commonwealth System of Higher Education
    Inventors: Stefan Niewiarowski, Cezary Marcinkiewicz
  • Trigramin - a platelet aggregation inhibiting polypeptide
    Patent number: 5066592
    Abstract: Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. The molecule is a potent inhibitor of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets. Trigramin is thus a potent inhibitor of fibrinogen-induced human platelet aggregation. It is useful in inhibiting the formation of hemostatic platelet plugs.
    Type: Grant
    Filed: September 19, 1990
    Date of Patent: November 19, 1991
    Assignee: Temple University of the Commonwealth System of Higher Education
    Inventors: Tur-Fu Huang, Stefan Niewiarowski, John C. Holt, Hanna Lukasiewicz