Patents by Inventor Stephane Varray

Stephane Varray has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • PROCESS FOR THE PRODUCTION OF PRAMLINTIDE
    Publication number: 20100249370
    Abstract: Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively.
    Type: Application
    Filed: June 30, 2008
    Publication date: September 30, 2010
    Applicant: LONZA AG
    Inventors: Andreas Brunner, Oleg Werbitzky, Stephane Varray, Francesca Quattrini, Holger Hermann, Andrew Strong, Fernando Albericio, Judit Tulla-Puche, Yesica Garcia Ramos
  • Method for Solid Phase Peptide Synthesis
    Publication number: 20080287648
    Abstract: A novel method for synthesizing a Hirulog peptide is devised.
    Type: Application
    Filed: October 19, 2005
    Publication date: November 20, 2008
    Applicant: LONZA AG
    Inventors: Anne-Sophie Droz, Jasmine Schnidrig, Nicole Studer, Stephane Varray, Corrine Wenger, Oleg Werbitzky
  • On-Resin Peptide Cyclization
    Publication number: 20080200647
    Abstract: Method of peptide synthesis, comprising the steps of a. synthesizing a peptide linked to a solid phase which peptide comprises at least one cysteine, homo- or nor-cysteine residue, which cysteine is protected in its side chain by a S-tert.butyl-sulphenyl group b. either coupling N-terminally a further amino acid having a 3,3?-dithio-(1-carboxy-propyl)-propionyl-radical on its N? or deprotecting the N? of the N-terminal amino acid and reacting the free N? with 3,3?-dithio-propionic acid imide to yield the corresponding N?-3,3?-dithio-(1-carboxy-propyl)-propionamide or deprotecting the N? of the N-terminal amino acid and reacting the free N? with a compound of formula IV R7-S—S—[CH2]2—COOH IV wherein R7 is aryl-, including heteronuclear aryl, or is aralkyl-, alkylaryl- or alkyl-, which may be further substituted with halogeno, amido, ester, carboxy or ether, and c. reacting the peptide with a S-tert.Butyl-sulphenyl-protection group removing reagent, and d.
    Type: Application
    Filed: October 18, 2005
    Publication date: August 21, 2008
    Applicant: LONZA AG
    Inventors: Stephane Varray, Oleg Werbitzky, Thomas Zeiter
  • S-Alkyl-Sulphenyl Protection Groups in Solid-Phase Synthesis
    Publication number: 20080108790
    Abstract: A novel method for on-resin formation of disulfide-borne cyclization of peptides is devised.
    Type: Application
    Filed: October 26, 2005
    Publication date: May 8, 2008
    Applicant: LONZA AG
    Inventors: Stephane Varray, Oleg Werbitzky, Thomas Zeiter
  • Cyclization of a Peptide
    Publication number: 20080097079
    Abstract: An improved method for cyclization of peptide (H)-D-Phe-Cys-Tyr-D-Trp-Lys-Val-Cys-Trp(NH2) by cystine formation is devised.
    Type: Application
    Filed: October 24, 2005
    Publication date: April 24, 2008
    Inventors: Francesca Quattrini, Stephane Varray, Oleg Werbitzky, Thomas Zeiter