Patents by Inventor Stephane Varray

Stephane Varray has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Synthesis of glucagon-like peptide
    Patent number: 9040480
    Abstract: A new method of synthesizing GLP-1 peptide is devised.
    Type: Grant
    Filed: April 29, 2013
    Date of Patent: May 26, 2015
    Assignee: LONZA AG
    Inventors: Oleg Werbitzky, Stéphane Varray, Matthieu Giraud, Carsten Meininghaus
  • Synthesis of glucagon-like peptide
    Patent number: 8445433
    Abstract: A new method of synthesizing GLP-1 peptide is devised.
    Type: Grant
    Filed: January 11, 2007
    Date of Patent: May 21, 2013
    Assignee: Lonza AG
    Inventors: Oleg Werbitzky, Stéphane Varray, Matthieu Giraud, Carsten Meininghaus
  • On-resin peptide cyclization
    Patent number: 7994280
    Abstract: A novel compound of formula I is devised.
    Type: Grant
    Filed: October 18, 2005
    Date of Patent: August 9, 2011
    Assignee: Lonza AG
    Inventors: Stéphane Varray, Oleg Werbitzky, Thomas Zeiter
  • Method for solid phase peptide synthesis
    Patent number: 7939629
    Abstract: A novel method for synthesizing a Hirulog peptide is devised.
    Type: Grant
    Filed: October 19, 2005
    Date of Patent: May 10, 2011
    Assignee: Lonza AG
    Inventors: Anne-Sophie Droz, Jasmine Schnidrig, Nicole Studer, Stéphane Varray, Corinne Wenger, Oleg Werbitzky
  • PROCESS FOR THE PRODUCTION OF EXENATIDE AND OF AN EXENATIDE ANALOGUE
    Publication number: 20110046349
    Abstract: Exenatide, a polypeptide having the 39 amino acid sequence H-1His-Gly-Glu-Gly-5Thr-Phe-Thr-Ser-Asp-10Leu-Ser- Lys-Gln-Met-15Glu-Glu-Glu--Ala-Val-20Arg-Leu-Phe- Ile-Glu-25Trp-Leu-Lys-Asn-Gly-30Gly-Pro-Ser-Ser- Gly-35Ala--Pro-Pro-Pro-Ser-NH2, respectively its 44-mer analogue H-1His-Gly-Glu-Gly-5Thr-Phe-Thr-Ser-Asp-10Leu-Ser- Lys-Gln-Met-15Glu-Glu-Glu--Ala-Val-20Arg-Leu-Phe- Ile-Glu-25Trp-Leu-Lys-Asn-Gly-30Gly-Pro-Ser-Ser- Gly-35Ala--Pro-Pro-Ser-Lys-40Lys-Lys-Lys-Lys-Lys- NH2 is prepared via a convergent four-fragment synthesis strategy from the fragments comprising the amino acid positions 1-10, 11-21, 22-29 and 30-39, respectively 30-44.
    Type: Application
    Filed: July 14, 2010
    Publication date: February 24, 2011
    Inventors: Matthieu Giraud, Anne-Sophie Droz, Stéphane Varray, El Djouhar Rekai, Marie-Hèléne Brichard, Daniel Latassa, Christine Devijver, Pascal Gilles, Jeanne-Marie Cauvin, Fernando Albericio, Marta Paradis Bas
  • PROCESS FOR THE PRODUCTION OF PRAMLINTIDE
    Publication number: 20100249370
    Abstract: Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively.
    Type: Application
    Filed: June 30, 2008
    Publication date: September 30, 2010
    Applicant: LONZA AG
    Inventors: Andreas Brunner, Oleg Werbitzky, Stephane Varray, Francesca Quattrini, Holger Hermann, Andrew Strong, Fernando Albericio, Judit Tulla-Puche, Yesica Garcia Ramos
  • SYNTHESIS OF GLUCAGON-LIKE PEPTIDE
    Publication number: 20090292106
    Abstract: A new method of synthesizing GLP-1 peptide is devised.
    Type: Application
    Filed: January 11, 2007
    Publication date: November 26, 2009
    Inventors: Oleg Werbitzky, Stéphane Varray, Matthieu Giraud, Carsten Meininghaus
  • Method for Solid Phase Peptide Synthesis
    Publication number: 20080287648
    Abstract: A novel method for synthesizing a Hirulog peptide is devised.
    Type: Application
    Filed: October 19, 2005
    Publication date: November 20, 2008
    Applicant: LONZA AG
    Inventors: Anne-Sophie Droz, Jasmine Schnidrig, Nicole Studer, Stephane Varray, Corrine Wenger, Oleg Werbitzky
  • On-Resin Peptide Cyclization
    Publication number: 20080200647
    Abstract: Method of peptide synthesis, comprising the steps of a. synthesizing a peptide linked to a solid phase which peptide comprises at least one cysteine, homo- or nor-cysteine residue, which cysteine is protected in its side chain by a S-tert.butyl-sulphenyl group b. either coupling N-terminally a further amino acid having a 3,3?-dithio-(1-carboxy-propyl)-propionyl-radical on its N? or deprotecting the N? of the N-terminal amino acid and reacting the free N? with 3,3?-dithio-propionic acid imide to yield the corresponding N?-3,3?-dithio-(1-carboxy-propyl)-propionamide or deprotecting the N? of the N-terminal amino acid and reacting the free N? with a compound of formula IV R7-S—S—[CH2]2—COOH IV wherein R7 is aryl-, including heteronuclear aryl, or is aralkyl-, alkylaryl- or alkyl-, which may be further substituted with halogeno, amido, ester, carboxy or ether, and c. reacting the peptide with a S-tert.Butyl-sulphenyl-protection group removing reagent, and d.
    Type: Application
    Filed: October 18, 2005
    Publication date: August 21, 2008
    Applicant: LONZA AG
    Inventors: Stephane Varray, Oleg Werbitzky, Thomas Zeiter
  • S-Alkyl-Sulphenyl Protection Groups in Solid-Phase Synthesis
    Publication number: 20080108790
    Abstract: A novel method for on-resin formation of disulfide-borne cyclization of peptides is devised.
    Type: Application
    Filed: October 26, 2005
    Publication date: May 8, 2008
    Applicant: LONZA AG
    Inventors: Stephane Varray, Oleg Werbitzky, Thomas Zeiter
  • Cyclization of a Peptide
    Publication number: 20080097079
    Abstract: An improved method for cyclization of peptide (H)-D-Phe-Cys-Tyr-D-Trp-Lys-Val-Cys-Trp(NH2) by cystine formation is devised.
    Type: Application
    Filed: October 24, 2005
    Publication date: April 24, 2008
    Inventors: Francesca Quattrini, Stephane Varray, Oleg Werbitzky, Thomas Zeiter
  • Method for solid phase peptide synthesis
    Patent number: RE46830
    Abstract: A novel method for synthesizing a Hirulog peptide is devised.
    Type: Grant
    Filed: March 17, 2015
    Date of Patent: May 8, 2018
    Assignee: Polypeptide Laboratories Holding (PPL) AB
    Inventors: Anne-Sophie Droz, Jasmine Schnidrig, Nicole Studer, Stéphane Varray, Corinne Wenger, Oleg Werbitzky