Patents by Inventor Thomas G. Boyer

Thomas G. Boyer has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20170319649
    Abstract: Certain embodiments are directed to compositions and methods for treating conditions associated Med12 mutations. Certain embodiments are directed to a peptide comprising all or part of an amino acid sequence that is at least 90% identical to the ammo acid sequence of MAAFGILSYEHRPLKRPRLGPPDVYPQDPKQKEDELTALNVKQGFNNQPAVSGDEHGSAKNVSFNPAKISSNFSSIIAEKLRCNTLPDT (SEQ ID NO:1). In certain aspects a peptide can comprise 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100 consecutive amino acids that is 90, 95, or 100% identical SEQ ID NO:1. In certain embodiments a peptide described herein can be comprised in a pharmaceutical composition. Certain aspects are directed to an expression vector encoding a peptide as described herein.
    Type: Application
    Filed: November 19, 2015
    Publication date: November 9, 2017
    Applicant: The Board of Regents of the University of Texsas System
    Inventors: Thomas G. BOYER, Jason M. SPAETH, Alison D. CLARK
  • Publication number: 20110059900
    Abstract: Provided herein are methods and compositions related to diagnosing and treating hormone resistant cancers.
    Type: Application
    Filed: August 9, 2010
    Publication date: March 10, 2011
    Applicant: Board of Regents, The University of Texas System
    Inventors: Thomas G. Boyer, Amy M. Trauernicht
  • Patent number: 7807383
    Abstract: Provided herein are methods and compositions related to diagnosing and treating hormone resistant cancers.
    Type: Grant
    Filed: April 17, 2008
    Date of Patent: October 5, 2010
    Assignee: Board of Regents, The University of Texas System
    Inventors: Thomas G. Boyer, Amy M. Trauernicht
  • Publication number: 20090062179
    Abstract: Provided herein are methods and compositions related to diagnosing and treating hormone resistant cancers.
    Type: Application
    Filed: April 17, 2008
    Publication date: March 5, 2009
    Applicant: THE BOARD OF REGENTS OF THE UNIVERSITY OF TEXAS SYSTEM
    Inventors: Thomas G. Boyer, Amy M. Trauernicht