Patents by Inventor Valdis M. Berzin

Valdis M. Berzin has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 4751287
    Abstract: The human leukocyte interferon is essentially a protein featuring the foling sequence of aminoacids:CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAF HEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNE DSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD.A method for producing said interferon N is bacterial cells incorporates isolation of matrix poly (A)-mRNA from induced human leukocytes, synthesis of the gene of said interferon, insertion in the vector plasmid pBR 322 under the control of a tryptophane promotor, and transformation of the resultant recombinant DNA of the E. coli bacterial cells.According to the invention, used as the interferon gene is the gene of interferon N featuring the following primary structure of DNA: ##STR1## The human leukocyte interferon features an antiviral potency and can find application in medical practice.
    Type: Grant
    Filed: September 28, 1984
    Date of Patent: June 14, 1988
    Assignees: Institut Organicheskogo Sinteza Akademii Nauk Latviiskoi SSR, Institut Bioorganicheskoi Khimii Imeni M.M. Shemyakina akademii Nauk SSR
    Inventors: Valdis M. Berzin, Alexandr J. Tsimanis, Jury I. Vishnevsky, Uldis R. Apsalon, Andris V. Dishler, Elmar Y. Gren, Evgeny D. Sverdlov, Galina S. Monastyrskaya, Sergei A. Tsarev, Alexandr A. Smorodintsev, Vladimir I. Iovlev, Guna Y. Feldmane, Arnis E. Duk