Patents by Inventor Walter F. Bodmer

Walter F. Bodmer has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Monoclonal antibodies for use in diagnosis and treatment of colorectal cancer
    Patent number: 5965710
    Abstract: A molecule which (i) binds human membrane-bound carcinoembryonic antigen, (ii) binds a hybrid polypeptide consisting of residues 1 to 314 of human biliary glycoprotein joined (N-C) to residues 490 to C-terminus of human carcino embryonic antigen, but (iii) does not bind to human biliary glycoprotein excluding an intact mouse monoclonal antibody comprising an IgG group IIA heavy chain and a kappa group V light chain wherein the sequence of the V.sub.H chain is QVKLQQSGPELKKPGETVKISCKASGYTFTVFGMNWVKQAPGKGLKWMGWIN-TKTGEATYVEEFKGRFAFSLE TSATTAYLQINNLKNEDTAKYFCARWDFYDYVEAMDYWGQGTTVTVSS, or wherein the sequence of the V.sub.H chain is as given immediately above but the first amino acid residue of the V.sub.H CDR1 is glutamine and in either case the sequence of the V.sub.L chain is GDIVMTQSQRFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKALIYSASYRYSGVPDRFTGSG-SGTDFT LTISNVQSEDLAEYFCHQYYTYPLFTFGSGTKLEMKR. Preferably the molecule is a monoclonal antibody.
    Type: Grant
    Filed: February 23, 1996
    Date of Patent: October 12, 1999
    Assignee: Imperial Cancer Research Technology Limited
    Inventors: Walter F Bodmer, Helga Durbin, David Snary, Lorna M D Stewart, Susan Young, Paul A Bates
  • Chromosome-specific nucleic acid probe for familial Polyposis coli
    Patent number: 5098823
    Abstract: A nucleic acid fragment capable of selectively hybridizing with the human chromosome 5 at the chromosomal region 5q20-q23 is disclosed. Also disclosed are probes which include the fragment bearing a detectable level as well as processes for presymptomatic screening for FAP and processes for the pathological classification of colonic tumors and precancerous polyps.
    Type: Grant
    Filed: April 12, 1990
    Date of Patent: March 24, 1992
    Assignee: Imperial Cancer Research Technology Ltd.
    Inventors: Walter F. Bodmer, Victoria A. Murday, Carolyn J. Bailey, Robert Williamson