Patents by Inventor Wenjuan Zha

Wenjuan Zha has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • KETOREDUCTASE POLYPEPTIDES FOR THE PREPARATION OF PHENYLEPHRINE
    Publication number: 20220267744
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Application
    Filed: April 28, 2022
    Publication date: August 25, 2022
    Inventors: Oscar Alvizo, Steven J. Collier, Hans-Georg Joerg Hennemann, Seong Ho Oh, Wenjuan Zha
  • Ketoreductase polypeptides for the preparation of phenylephrine
    Patent number: 11345898
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Grant
    Filed: October 30, 2020
    Date of Patent: May 31, 2022
    Assignee: Codexis, Inc.
    Inventors: Oscar Alvizo, Steven J. Collier, Hans-Georg Joerg Hennemann, Seong Ho Oh, Wenjuan Zha
  • KETOREDUCTASE POLYPEPTIDES FOR THE PREPARATION OF PHENYLEPHRINE
    Publication number: 20210062162
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Application
    Filed: October 30, 2020
    Publication date: March 4, 2021
    Inventors: Oscar Alvizo, Steven J. Collier, Hans-Georg Joerg Hennemann, Seong Ho Oh, Wenjuan Zha
  • Ketoreductase polypeptides for the preparation of phenylephrine
    Patent number: 10870835
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Grant
    Filed: January 31, 2020
    Date of Patent: December 22, 2020
    Assignee: Codexis, Inc.
    Inventors: Oscar Alvizo, Steven J. Collier, Hans-Georg Joerg Hennemann, Seong Ho Oh, Wenjuan Zha
  • KETOREDUCTASE POLYPEPTIDES FOR THE PREPARATION OF PHENYLEPHRINE
    Publication number: 20200157511
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Application
    Filed: January 31, 2020
    Publication date: May 21, 2020
    Inventors: Oscar Alvizo, Steven J. Collier, Hans-Georg Joerg Hennemann, Seong Ho Oh, Wenjuan Zha
  • Ketoreductase polypeptides for the preparation of phenylephrine
    Patent number: 10590396
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Grant
    Filed: June 11, 2019
    Date of Patent: March 17, 2020
    Assignee: Codexis, Inc.
    Inventors: Oscar Alvizo, Steven J. Collier, Hans-Georg Joerg Hennemann, Seong Ho Oh, Wenjuan Zha
  • KETOREDUCTASE POLYPEPTIDES FOR THE PREPARATION OF PHENYLEPHRINE
    Publication number: 20190309267
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Application
    Filed: June 11, 2019
    Publication date: October 10, 2019
    Inventors: Oscar Alvizo, Steven J. Collier, Hans-Georg Joerg Hennemann, Seong Ho Oh, Wenjuan Zha
  • Ketoreductase polypeptides for the preparation of phenylephrine
    Patent number: 10358631
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Grant
    Filed: November 14, 2017
    Date of Patent: July 23, 2019
    Assignee: Codexis, Inc.
    Inventors: Oscar Alvizo, Steven J. Collier, Hans-Georg Joerg Hennemann, Seong Ho Oh, Wenjuan Zha
  • Antibody-fynomer conjugates
    Patent number: 10323095
    Abstract: Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.
    Type: Grant
    Filed: March 16, 2015
    Date of Patent: June 18, 2019
    Assignee: MITSUBISHI TANABE PHARMA CORPORATION
    Inventors: Roland Newman, Steve Granger, Michael Lyman, Dragan Grabulovski, Richard Woods, Michela Silacci, Wenjuan Zha, Isabella Attinger-Toller
  • KETOREDUCTASE POLYPEPTIDES FOR THE PREPARATION OF PHENYLEPHRINE
    Publication number: 20180066239
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Application
    Filed: November 14, 2017
    Publication date: March 8, 2018
    Inventors: Oscar Alvizo, Steven J. Collier, Hans-Georg Joerg Hennemann, Seong Ho Oh, Wenjuan Zha
  • Ketoreductase polypeptides for the preparation of phenylephrine
    Patent number: 9834758
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Grant
    Filed: June 30, 2015
    Date of Patent: December 5, 2017
    Assignee: Codexis, Inc.
    Inventors: Oscar Alvizo, Steven J. Collier, Hans-Georg Joerg Hennemann, Seong Ho Oh, Wenjuan Zha
  • ANTIBODY-FYNOMER CONJUGATES
    Publication number: 20170081412
    Abstract: Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.
    Type: Application
    Filed: March 16, 2015
    Publication date: March 23, 2017
    Applicant: MITSUBISHI TANABE PHARMA CORPORATION
    Inventors: Roland NEWMAN, Steve GRANGER, Michael LYMAN, Dragan GRABULOVSKI, Richard WOODS, Michela SILACCI, Wenjuan ZHA, Isabella ATTINGER-TOLLER
  • IL-17A binding molecules and medical uses thereof
    Patent number: 9315557
    Abstract: The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.
    Type: Grant
    Filed: September 19, 2013
    Date of Patent: April 19, 2016
    Assignee: Covagen AG
    Inventors: Michela Sillacci Melkko, Nadja Banziger, Richard Woods, Wenjuan Zha, Isabella Attinger, Roger Santimaria, Wibke Lembke, Sarah Batey, Ulrike Von Der Bey, Julian Bertschinger, Dragan Grabulovski
  • NOVEL IL-17A BINDING MOLECULES AND MEDICAL USES THEREOF
    Publication number: 20150322125
    Abstract: The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.
    Type: Application
    Filed: September 19, 2013
    Publication date: November 12, 2015
    Inventors: Michela SILACCI MELKKO, Nadja BANZIGER, Richard WOODS, Wenjuan ZHA, Isabella ATTINGER, Roger SANTIMARIA, Wibke LEMBKE, Sarah BATEY, Ulrike VON DER BEY, Julian BERTSCHINGER, Dragan GRABULOVSKI
  • KETOREDUCTASE POLYPEPTIDES FOR THE PREPARATION OF PHENYLEPHRINE
    Publication number: 20150299671
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Application
    Filed: June 30, 2015
    Publication date: October 22, 2015
    Inventors: Oscar Alvizo, Steven J. Collier, Hans-Georg Joerg Hennemann, Seong Ho Oh, Wenjuan Zha
  • Ketoreductase polypeptides for the preparation of phenylephrine
    Patent number: 9102959
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Grant
    Filed: August 19, 2010
    Date of Patent: August 11, 2015
    Assignee: Codexis, Inc.
    Inventors: Oscar Alvizo, Steven J. Collier, Joerg Hennemann, Seong Ho Oh, Wenjuan Zha
  • Ketoreductase Polypeptides for the Preparation of Phenylephrine
    Publication number: 20120149073
    Abstract: The disclosure relates to engineered ketoreductase polypeptides and processes of using the polypeptides for production of phenylephrine.
    Type: Application
    Filed: August 19, 2010
    Publication date: June 14, 2012
    Applicant: CODEXIS, INC.
    Inventors: Oscar Alvizo, Steven J. Collier, Joerg Hennemann, Seong Ho Oh, Wenjuan Zha