Patents by Inventor Wilson Romero Caparros-Wanderlay

Wilson Romero Caparros-Wanderlay has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • HIV and immunogenic peptide sequences and compositions
    Patent number: 10034933
    Abstract: The present specification discloses an immunogenic composition comprising polypeptide, wherein each of the polypeptides has no more than 100 amino acids, which polypeptides comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope, wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.
    Type: Grant
    Filed: May 5, 2017
    Date of Patent: July 31, 2018
    Assignee: PepTcell, Ltd.
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderlay
  • Peptide Sequences and Compositions
    Publication number: 20170281750
    Abstract: The present specification discloses an immunogenic composition comprising polypeptide, wherein each of the polypeptides has no more than 100 amino acids, which polypeptides comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope, wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.
    Type: Application
    Filed: May 5, 2017
    Publication date: October 5, 2017
    Applicant: PepTcell, Ltd.
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderlay
  • HIV peptides and immunogenic compositions
    Patent number: 9675686
    Abstract: The present specification discloses an immunogenic composition comprising polypeptide, wherein each of the polypeptides has no more than 100 amino acids, which polypeptides comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope, wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.
    Type: Grant
    Filed: March 12, 2015
    Date of Patent: June 13, 2017
    Assignee: PepTcell, Ltd.
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderlay
  • Peptide Sequences and Compositions
    Publication number: 20150182618
    Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope: SEQ?ID?1 GDTWAGVEAIIRILQQLLFIHFRIGCQHSR SEQ?ID?2 KVGSLQYLALTALITPKKIKPPLPSVKKLTEDRWNKPQKT SEQ?ID?3 EPVPLQLPPLERLTLDCSEDCGTSGTQ SEQ?ID?4 YKGALDLSHFLKEKGGLEGLIYSQKRQDILDLWVYHTQGYFPD wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.
    Type: Application
    Filed: March 12, 2015
    Publication date: July 2, 2015
    Applicant: PepTcell, Ltd.
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderlay
  • Peptide Sequences of HIV polypeptides and compositions thereof
    Patent number: 8992934
    Abstract: The present specification discloses an immunogenic composition comprising polypeptide, wherein each of the polypeptides has no more than 100 amino acids, which polypeptides comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope, wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.
    Type: Grant
    Filed: June 18, 2012
    Date of Patent: March 31, 2015
    Assignee: PepTcell Limited
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderlay
  • Peptide Sequences and Compositions
    Publication number: 20130039937
    Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope: SEQ?ID?1 GDTWAGVEAIIRILQQLLFIHFRIGCQHSR SEQ?ID?2 KVGSLQYLALTALITPKKIKPPLPSVKKLTEDRWNKPQKT SEQ?ID?3 EPVPLQLPPLERLTLDCSEDCGTSGTQ SEQ?ID?4 YKGALDLSHFLKEKGGLEGLIYSQKRQDILDLWVYHTQGYFPD wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.
    Type: Application
    Filed: June 18, 2012
    Publication date: February 14, 2013
    Inventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderlay