Abstract: The present disclosure relates to a cell penetrating short peptide TAT-HuR-HNS-3 and application thereof in inflammatory disease, wherein the amino acid sequence of cell penetrating short peptide TAT-HuR-HNS-3 for inflammatory diseases caused by elevated inflammatory factors is YGRKKRRQRRR-SPMGVDHMSGLSGVNVPGNASSG, the inflammatory diseases caused by elevated inflammatory factors include lung inflammation, asthma, pollen allergy, and nephritis; TAT-HuR-HNS-3 may specifically inhibit the interaction of HuR-PARP1/HuR-HuR and the expression of inflammatory factors, and has no effect on cell proliferation and survival. This provides a safety guarantee for the drug development of cell penetrating peptides, and is a new method applied to the treatment of inflammatory diseases.