Abstract: An object of the present invention is to provide an anti-tumor agent and an anti-tumor kit which have superior anti-tumor effect as compared with a therapy with gemcitabine, paclitaxel or a combination thereof; as well as an anti-tumor effect enhancer. According to the present invention, provided is an anti-tumor agent including paclitaxel or a salt thereof and 1-(2-deoxy-2-fluoro-4-thio-?-D-arabinofuranosyl)cytosine or a salt or prodrug thereof.

Abstract: A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 ?M in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids

Abstract: A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Abstract: An object of the present invention is to provide an anti-tumor agent and an anti-tumor kit which have superior anti-tumor effect as compared with a therapy with gemcitabine, paclitaxel or a combination thereof; as well as an anti-tumor effect enhancer. According to the present invention, provided is an anti-tumor agent including paclitaxel or a salt thereof and 1-(2-deoxy-2-fluoro-4-thio-?-D-arabinofuranosyl)cytosine or a salt or prodrug thereof.

Abstract: An object of the present invention is to provide lipid particles which have low cytotoxicity, can stably hold nucleic acid molecules outside cells, and can promptly release nucleic acids in cytoplasm after escaping from endosome, and a nucleic acid delivery carrier. According to the present invention, there are provided lipid particles containing a compound represented by the following General Formula (1), sterol, at least one lipid selected from the group consisting of a neutral lipid and a lipid having a polyethylene glycol chain, and nucleic acids, and a nucleic acid delivery carrier. In the formula, R1 and R2 are the same as or different from each other, and are alkyl groups having 10 to 22 carbon atoms.

Abstract: A polypeptide composition induces a pluripotent stem cell culturing property, particularly, an excellent cell growth ability. The polypeptide composition contains a predetermined polypeptide including an amino acid sequence of human vitronectin or an amino acid sequence of a predetermined first region derived from human vitronectin. The polypeptide composition includes a multimeric polypeptide, which is composed of two or more monomers held together by intermolecular cross-linking via cysteine residues included in the first region, in an amount equal to or less than 20% by mass of a total mass of polypeptides contained in the composition. A culture method for pluripotent stem cells includes culturing pluripotent stem cells in the presence of the polypeptide composition. Also provided is a culture vessel including a support which has a cell culture surface and the polypeptide contained in the polypeptide composition disposed on the cell culture surface of the support.

Abstract: An object of the present invention is to provide lipid particles which have low cytotoxicity, can stably hold nucleic acid molecules outside cells, and can promptly release nucleic acids in cytoplasm after escaping from endosome, and a nucleic acid delivery carrier. According to the present invention, there are provided lipid particles containing a compound represented by the following General Formula (1), sterol, at least one lipid selected from the group consisting of a neutral lipid and a lipid having a polyethylene glycol chain, and nucleic acids, and a nucleic acid delivery carrier. In the formula, R1 and R2 are the same as or different from each other, and are alkyl groups having 10 to 22 carbon atoms.

Abstract: A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Abstract: A polypeptide composition induces a pluripotent stem cell culturing property, particularly, an excellent cell growth ability. The polypeptide composition contains a predetermined polypeptide including an amino acid sequence of human vitronectin or an amino acid sequence of a predetermined first region derived from human vitronectin. The polypeptide composition includes a multimeric polypeptide, which is composed of two or more monomers held together by intermolecular cross-linking via cysteine residues included in the first region, in an amount equal to or less than 20% by mass of a total mass of polypeptides contained in the composition. A culture method for pluripotent stem cells includes culturing pluripotent stem cells in the presence of the polypeptide composition. Also provided is a culture vessel including a support which has a cell culture surface and the polypeptide contained in the polypeptide composition disposed on the cell culture surface of the support.

Abstract: A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 ?M in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids

Abstract: A culture method for pluripotent stem cells includes obtaining a polypeptide-coated culture surface by applying a polypeptide to a cell culture surface of a support, and culturing pluripotent stem cells by seeding the pluripotent stem cells onto the polypeptide-coated culture surface by using a medium in which the content of an ascorbic acid derivative is equal to or greater than 1.5 mmol/L (mM), in which the polypeptide is (a) a polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (b) a polypeptide having an amino acid sequence, which shares identity of equal to or higher than 80% with the amino acid sequence represented by SEQ ID NO: 1, and having culture performance for pluripotent stem cells, or (c) a polypeptide having an amino acid sequence, which is formed by the deletion, substitution, or addition of one amino acid or several amino acids in SEQ ID NO: 1, and having culture performance for pluripotent stem cells.

Abstract: A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Abstract: An object to be achieved by the present invention is to provide a nucleic acid amplification method by which a nucleic acid can be amplified substantially isothermally using oligonucleotide primers and DNA polymerase capable of strand displacement. The present invention provides a nucleic acid amplification method which comprises performing substantially isothermal incubation of a reaction solution containing at least one type of deoxynucleotide triphosphate, at least one type of DNA polymerase having strand displacement activity, a divalent cation, at least 0.01% or more surfactant, at least two types of oligonucleotide primer, and the nucleic acid fragment as a template so as to perform a polymerase reaction that initiates from the 3? end of the primer and thus amplifying the nucleic acid fragment.

Abstract: An object to be achieved by the present invention is to provide a nucleic acid amplification method by which a nucleic acid can be amplified using oligonucleotide primers and DNA polymerase.

Abstract: The present invention describes methods for discriminating between nucleotide sequences of first and second nucleic acids, including: providing a reaction solution, including a deoxynucleotide triphosphate, a DNA polymerase with strand displacement ability, a template nucleic acid fragment, a primer, and a mask oligo; incubating the reaction solution, obtaining a polymerase reaction, and producing an amplification product; detecting the amplification product to discriminate between the nucleotide sequences, wherein the primer is complementary to the first nucleic acid, the mask oligo hybridizes to the nucleotide sequence portion of the first and second nucleic acid, wherein the mask oligo is more complementary to the second nucleic acid than to the first nucleic acid, and wherein the mask oligo is not an origin of an elongation reaction with the polymerase, and a primer portion and a mask oligo portion hybridize to the same regions on the first and second nucleic acid.

Abstract: There is provided a method for analyzing nucleic acid mutation using an array comparative genomic hybridization technique, which reduces the false positive and the false negative and improves the reliability of the analysis results. A method for analyzing nucleic acid mutation using array comparative genomic hybridization technique comprising: [(a) a step of bringing a plurality of labeled sample nucleic acids one by one into contact with the plural same probe nucleic acid sets], [(b) a step of obtaining label intensities], [(c) a step of determining whether each piece of comparison values falls within a prescribed numerical value range or not], and [(d) a step of comparing whether the number of the comparison values exceeds a prescribed number or not and, in the case of exceeding the prescribed number, judging the spot positive].

Abstract: It is an object of the present invention to provide a method for replicating a nucleic acid sequence using oligonucleotide primers and DNA polymerase. The present invention provides a method for replicating a nucleic acid sequence, which comprises synthesizing a complementary strand with a polymerase that catalyzes a strand displacement complementary strand synthesis reaction, wherein a double-stranded template nucleic acid having a sequence A(Ac) consisting of 20 or more to 200 or less contiguous nucleotides at both ends is used as an origin.

Abstract: It is an object of the present invention to provide a method for amplifying a nucleic acid, which does not require complicated temperature control and which can be carried out without using special enzyme or special primers. The present invention provides a method for amplifying a nucleic acid, which comprises the following steps (1) and (2): (1) a step of incubating a reaction solution containing at least one type of deoxynucleotide triphosphate, at least one type of DNA polymerase, at least two types of oligonucleotide primers, and a nucleic acid fragment acting as a template, at temperature (T1); and (2) a step of incubating the reaction solution at temperature (T2) that is higher than the temperature (T1) and is between 50° C. or higher and 100° C. or lower, following the step (1).

Abstract: It is an object of the present invention to provide a method for discriminating between nucleic acid sequences with high accuracy by utilizing a method for specifically amplifying nucleic acid sequences under isothermal conditions.

Abstract: An object to be achieved by the present invention is to provide a nucleic acid amplification method by which a nucleic acid can be amplified substantially isothermally using oligonucleotide primers and DNA polymerase capable of strand displacement. The present invention provides a nucleic acid amplification method which comprises performing substantially isothermal incubation of a reaction solution containing at least one type of deoxynucleotide triphosphate, at least one type of DNA polymerase having strand displacement activity, a divalent cation, at least 0.01% or more surfactant, at least two types of oligonucleotide primer, and the nucleic acid fragment as a template so as to perform a polymerase reaction that initiates from the 3? end of the primer and thus amplifying the nucleic acid fragment.